Property Summary

NCBI Gene PubMed Count 17
PubMed Score 87.44
PubTator Score 273.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.200 3.7e-02
ependymoma -1.100 4.8e-05
group 3 medulloblastoma -1.300 9.0e-03
intraductal papillary-mucinous adenoma (... 1.100 4.9e-03
medulloblastoma, large-cell -2.600 5.3e-06
osteosarcoma -2.658 3.4e-07
pituitary cancer 1.300 1.0e-05
tuberculosis 1.100 2.2e-04

Gene RIF (5)

AA Sequence

MRSAAKPWNPAIRAGGHGPDRVRPLPAASSGMKSSKSSTSLAFESRLSRLKRASSEDTLNKPGSTAASGV      1 - 70
VRLKKTATAGAISELTESRLRSGTGAFTTTKRTGIPAPREFSVTVSRERSVPRGPSNPRKSVSSPTSSNT     71 - 140
PTPTKHLRTPSTKPKQENEGGEKAALESQVRELLAEAKAKDSEINRLRSELKKYKEKRTLNAEGTDALGP    141 - 210
NVDGTSVSPGDTEPMIRALEEKNKNFQKELSDLEEENRVLKEKLIYLEHSPNSEGAASHTGDSSCPTSIT    211 - 280
QESSFGSPTGNQMSSDIDEYKKNIHGNALRTSGSSSSDVTKASLSPDASDFEHITAETPSRPLSSTSNPF    281 - 350
KSSKCSTAGSSPNSVSELSLASLTEKIQKMEENHHSTAEELQATLQELSDQQQMVQELTAENEKLVDEKT    351 - 420
ILETSFHQHRERAEQLSQENEKLMNLLQERVKNEEPTTQEGKIIELEQKCTGILEQGRFEREKLLNIQQQ    421 - 490
LTCSLRKVEEENQGALEMIKRLKEENEKLNEFLELERHNNNMMAKTLEECRVTLEGLKMENGSLKSHLQG    491 - 560
EKQKATEASAVEQTAESCEVQEMLKVARAEKDLLELSCNELRQELLKANGEIKHVSSLLAKVEKDYSYLK    561 - 630
EICDHQAEQLSRTSLKLQEKASESDAEIKDMKETIFELEDQVEQHRAVKLHNNQLISELESSVIKLEEQK    631 - 700
SDLERQLKTLTKQMKEETEEWRRFQADLQTAVVVANDIKCEAQQELRTVKRKLLEEEEKNARLQKELGDV    701 - 770
QGHGRVVTSRAAPPPVDEEPESSEVDAAGRWPGVCVSRTSPTPPESATTVKSLIKSFDLGRPGGAGQNIS    771 - 840
VHKTPRSPLSGIPVRTAPAAAVSPMQRHSTYSSVRPASRGVTQRLDLPDLPLSDILKGRTETLKPDPHLR    841 - 910
KSPSLESLSRPPSLGFGDTRLLSASTRAWKPQSKLSVERKDPLAALAREYGGSKRNALLKWCQKKTQGYA    911 - 980
NIDITNFSSSWSDGLAFCALLHTYLPAHIPYQELNSQEKKRNLLLAFEAAESVGIKPSLELSEMLYTDRP    981 - 1050
DWQSVMQYVAQIYKYFET                                                       1051 - 1068
//

Text Mined References (25)

PMID Year Title