Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 5
Funding $270,422.25
PubMed Score 98.51
PubTator Score 83.69

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
25819896 rs17684886 (ZNRF1) and rs599019 (COLEC12) are associated with diabetic retinopathy and rs6427247 (SCYL1BP1) and rs899036 (API5) are associated with severe diabetic retinopathy in Chinese patients with type 2 diabetes
23333304 HIV-1 Vif downregulates the expression of collectin sub-family member 12 (COLEC12) in Vif-expression T cells
21561871 The common presence of Lewis(x) groups in granule protein glycans can thus target granule proteins for clearance by SRCL.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20034698 The Le(x) residues of both, CEACAM1 and CEA, interact with the human Le(x)-binding glycan receptors DC-SIGN and SRCL.
19073604 CL-P1 predominantly mediated phagocytosis for fungi in vascular endothelia.
18423602 CL-P1 is not a common membrane protein on endothelial cells found in normal tissues under steady state conditions.
15845541 SRCL might be involved in selective clearance of specific desialylated glycoproteins from circulation and/or interaction of cells bearing Lewis(x)-type structures with the vascular endothelium
12761161 SRCL is expressed in some but not all nurse-like cells; its C-type lectin domain binds specifically to several carbohydrates including GalNAc, T and Tn antigen in a Ca2+-dependent manner.
More...

AA Sequence

MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYKVVEKMDNVTG      1 - 70
GMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQ     71 - 140
ASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHNVVIMNLNNLN    141 - 210
LTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANN    211 - 280
DTLEDMNSQLNSFTGQMENITTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNI    281 - 350
SYTAHHLRTLTSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVI    351 - 420
MEEMKLVDSKHGQLIKNFTILQGPPGPRGPRGDRGSQGPPGPTGNKGQKGEKGEPGPPGPAGERGPIGPA    421 - 490
GPPGERGGKGSKGSQGPKGSRGSPGKPGPQGSSGDPGPPGPPGKEGLPGPQGPPGFQGLQGTVGEPGVPG    491 - 560
PRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTPAPEDNGCPPHWKNFTDKCYYFSVEKEIFED    561 - 630
AKLFCEDKSSHLVFINTREEQQWIKKQMVGRESHWIGLTDSERENEWKWLDGTSPDYKNWKAGQPDNWGH    631 - 700
GHGPGEDCAGLIYAGQWNDFQCEDVNNFICEKDRETVLSSAL                                701 - 742
//

Text Mined References (22)

PMID Year Title
25819896 2015 Common variants in or near ZNRF1, COLEC12, SCYL1BP1 and API5 are associated with diabetic retinopathy in Chinese patients with type 2 diabetes.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21561871 2011 Identification of neutrophil granule glycoproteins as Lewis(x)-containing ligands cleared by the scavenger receptor C-type lectin.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20351715 2011 Meta-analysis of genome-wide association data of bipolar disorder and major depressive disorder.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20034698 2010 DC-SIGN and SRCL bind glycans of carcinoembryonic antigen (CEA) and CEA-related cell adhesion molecule 1 (CEACAM1): recombinant human glycan-binding receptors as analytical tools.
19073604 2009 Scavenger receptor collectin placenta 1 (CL-P1) predominantly mediates zymosan phagocytosis by human vascular endothelial cells.
More...