Property Summary

NCBI Gene PubMed Count 17
PubMed Score 104.99
PubTator Score 83.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 2.9e-05
Atopic dermatitis -1.500 3.1e-03
colon cancer -3.000 3.5e-03
cystic fibrosis 4.403 2.6e-08
Duchenne muscular dystrophy 1.793 3.1e-08
ependymoma 1.200 1.6e-02
facioscapulohumeral dystrophy -1.600 6.5e-03
group 3 medulloblastoma -1.600 1.6e-03
intraductal papillary-mucinous adenoma (... -1.900 1.2e-03
intraductal papillary-mucinous carcinoma... -1.900 1.8e-03
juvenile dermatomyositis 1.324 1.3e-08
lung adenocarcinoma -1.100 1.0e-06
lung cancer -2.600 6.2e-04
lung carcinoma -2.800 3.7e-25
non-small cell lung cancer -1.912 6.6e-16
osteosarcoma 2.184 7.5e-03
ovarian cancer -3.400 1.9e-09
subependymal giant cell astrocytoma 2.368 1.1e-02

Protein-protein Interaction (8)

Gene RIF (11)

AA Sequence

MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYKVVEKMDNVTG      1 - 70
GMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQ     71 - 140
ASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHNVVIMNLNNLN    141 - 210
LTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANN    211 - 280
DTLEDMNSQLNSFTGQMENITTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNI    281 - 350
SYTAHHLRTLTSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVI    351 - 420
MEEMKLVDSKHGQLIKNFTILQGPPGPRGPRGDRGSQGPPGPTGNKGQKGEKGEPGPPGPAGERGPIGPA    421 - 490
GPPGERGGKGSKGSQGPKGSRGSPGKPGPQGSSGDPGPPGPPGKEGLPGPQGPPGFQGLQGTVGEPGVPG    491 - 560
PRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTPAPEDNGCPPHWKNFTDKCYYFSVEKEIFED    561 - 630
AKLFCEDKSSHLVFINTREEQQWIKKQMVGRESHWIGLTDSERENEWKWLDGTSPDYKNWKAGQPDNWGH    631 - 700
GHGPGEDCAGLIYAGQWNDFQCEDVNNFICEKDRETVLSSAL                                701 - 742
//

Text Mined References (22)

PMID Year Title