Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 9.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q5KSL6 B2RP91 DAG kinase kappa
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
26162297 Dgkk appears to be a marker or mediator of squamous cell differentiation in development of mouse external genitalia. No association exists between Dgkk expression and formation of preputial cleft in the genital tubercle of diethylsilbestrol treated mice.
25327554 Studied the relationship between DGKK single nucleotide polymorphisms (SNPs) and hypospadias risk in the Han Chinese population.
23728617 Treatment of human primary astrocytes with HIV-1 Vpr upregulates expression of six genes, APOE, CCL5, DGKK, GPX5, NOS2, and PXDNL
21113153 Common variants in DGKK are strongly associated with risk of hypospadias
16210324 DGK kappa is a novel human type II diacylglycerol kinase

AA Sequence

MDRGAAAAQGTAPPQDGEQPAESPEPPPPWPPPPPPPAPPPAPPLLSEASPEPIPEPCPELAPGPCPEAT      1 - 70
SESATELYTEPTPEPATEPASEPAPEPATEPAPEPATEPAPEPAPEPATESAPEPTPEPALESVPEPAPE     71 - 140
LTPEVAPELAPEPTPEPVTELAPEFCPEAAPEFRPSPAPCLLQCPVDTRERGLKTSPSPSPSPSPRTPMS    141 - 210
WSRIKKILKEGPMLKNCNSFKRWKLRYFLVQGQKLYFAHHPAFAHFETIDLSQATVAESSCRNLCHSFCV    211 - 280
ITPQRKITLAAPNRKDMEEWINIIKTIQQGEIYKIPAAENNPFLVGMHCWYSSYSHRTQHCNVCRESIPA    281 - 350
LSRDAIICEVCKVKSHRLCALRASKDCKWNTLSITDDLLLPADEVNMPHQWVEGNMPVSSQCAVCHESCG    351 - 420
SYQRLQDFRCLWCNSTVHDDCRRRFSKECCFRSHRSSVIPPTALSDPKGDGQLVVSSDFWNLDWSSACSC    421 - 490
PLLIFINSKSGDHQGIVFLRKFKQYLNPSQVFDLLKGGPEAGLSMFKNFARFRILVCGGDGSVSWVLSLI    491 - 560
DAFGLHEKCQLAVIPLGTGNDLARVLGWGAFWNKSKSPLDILNRVEQASVRILDRWSVMIRETPRQTPLL    561 - 630
KGQVEMDVPRFEAAAIQHLESAATELNKILKAKYPTEMIIATRFLCSAVEDFVVDIVKAWGQIKQNNTAI    631 - 700
VSVILKSDLMYDRLSVLIDVLAEEAAATSAEKSATEYADSSKADRKPFIPQIDHIAKCKLELATKAQSLQ    701 - 770
KSLKLIIFQVEQALDEESRQTISVKNFSSTFFLEDDPEDINQTSPRRRSRRGTLSSISSLKSEDLDNLNL    771 - 840
DHLHFTPESIRFKEKCVMNNYFGIGLDAKISLDFNTRRDEHPGQYNSRLKNKMWYGLLGTKELLQRSYRK    841 - 910
LEERVHLECDGETISLPNLQGIVVLNITSYAGGINFWGSNTATTEYEAPAIDDGKLEVVAIFGSVQMAMS    911 - 980
RIINLHHHRIAQCHEVMITIDGEEGIPVQVDGEAWIQRPGLIKIRYKNAAQMLTRDRDFENSMKMWEYKH    981 - 1050
TEIQAAPQPQLDFQDSQESLSDEEYAQMQHLARLAENLISKLNDLSKIHQHVSVLMGSVNASANILNDIF   1051 - 1120
YGQDSGNEMGAASCIPIETLSRNDAVDVTFSLKGLYDDTTAFLDEKLLRSAEDETALQSALDAMNKEFKK   1121 - 1190
LSEIDWMNPIFVPEEKSSDTDSRSLRLKIKFPKLGKKKVEEERKPKSGQSVQSFIGNLWHRRHREDEAEG   1191 - 1260
DDPLTPSRSQL                                                              1261 - 1271
//

Text Mined References (10)

PMID Year Title
26162297 2015 Expression Analysis of DGKK during External Genitalia Formation.
25327554 2015 Diacylglycerol kinase ? (DGKK) variants and hypospadias in Han Chinese: association and meta-analysis.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
23177175 2013 Diacylglycerol kinase K variants impact hypospadias in a California study population.
22371315 Aetiology of hypospadias: a systematic review of genes and environment.
21113153 2011 Common variants in DGKK are strongly associated with risk of hypospadias.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16210324 2005 Identification and characterization of a novel human type II diacylglycerol kinase, DGK kappa.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.