Property Summary

NCBI Gene PubMed Count 23
PubMed Score 27.03
PubTator Score 17.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.7
lung cancer 4740 0.0 0.5

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 1.667 2.1e-02
active ulcerative colitis 1.677 4.5e-02
adult high grade glioma 1.400 2.9e-06
Astrocytoma, Pilocytic 1.800 4.9e-06
Atopic dermatitis 1.300 4.8e-04
cutaneous lupus erythematosus 4.000 1.7e-05
cystic fibrosis 1.600 7.9e-05
diabetes mellitus -1.100 2.8e-03
ependymoma 1.500 6.3e-05
gastric cancer 1.100 8.5e-03
glioblastoma 1.300 7.4e-05
hepatocellular carcinoma 1.200 8.3e-04
interstitial cystitis 1.100 2.3e-02
intraductal papillary-mucinous adenoma (... 1.600 3.0e-04
intraductal papillary-mucinous carcinoma... 2.000 1.8e-03
intraductal papillary-mucinous neoplasm ... 2.700 2.8e-04
juvenile dermatomyositis 2.915 9.7e-15
lung carcinoma -1.800 2.8e-22
osteosarcoma -1.211 4.4e-02
ovarian cancer 2.400 7.9e-05
pancreatic cancer 1.700 6.5e-06
pancreatic ductal adenocarcinoma liver m... 1.906 2.6e-02
primary Sjogren syndrome 2.400 3.4e-05
psoriasis 2.000 3.2e-06
spina bifida -1.448 4.7e-02
subependymal giant cell astrocytoma 2.500 1.9e-02
Systemic lupus erythematosus 1.200 9.6e-04
tuberculosis and treatment for 6 months -1.200 1.2e-03

Synonym

Accession Q5K651 A2RU68 Q5K649 Q6P080 Q75N21 Q8IVG6 Q9NXS8 SAM domain-containing protein 9
Symbols NFTC
OEF1
OEF2
DRIF1
C7orf5
MIRAGE

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

AA Sequence

MAKQLNLPENTDDWTKEDVNQWLESHKIDQKHREILTEQDVNGAVLKWLKKEHLVDMGITHGPAIQIEEL      1 - 70
FKELRKTAIEDSIQTSKMGKPSKNAPKDQTVSQKERRETSKQKQKGKENPDMANPSAMSTTAKGSKSLKV     71 - 140
ELIEDKIDYTKERQPSIDLTCVSYPFDEFSNPYRYKLDFSLQPETGPGNLIDPIHEFKAFTNTATATEED    141 - 210
VKMKFSNEVFRFASACMNSRTNGTIHFGVKDKPHGKIVGIKVTNDTKEALINHFNLMINKYFEDHQVQQA    211 - 280
KKCIREPRFVEVLLPNSTLSDRFVIEVDIIPQFSECQYDYFQIKMQNYNNKIWEQSKKFSLFVRDGTSSK    281 - 350
DITKNKVDFRAFKADFKTLAESRKAAEEKFRAKTNKKEREGPKLVKLLTGNQDLLDNSYYEQYILVTNKC    351 - 420
HPDQTKHLDFLKEIKWFAVLEFDPESNINGVVKAYKESRVANLHFPSVYVEQKTTPNETISTLNLYHQPS    421 - 490
WIFCNGRLDLDSEKYKPFDPSSWQRERASDVRKLISFLTHEDIMPRGKFLVVFLLLSSVDDPRDPLIETF    491 - 560
CAFYQDLKGMENILCICVHPHIFQGWKDLLEARLIKHQDEISSQCISALSLEEINGTILKLKSVTQSSKR    561 - 630
LLPSIGLSTVLLKKEEDIMTALEIICENECEGTLLEKDKNKFLEFKASKEEDFYRGGKVSWWNFYFSSES    631 - 700
YSSPFVKRDKYERLEAMIQNCADSSKPTSTKIIHLYHHPGCGGTTLAMHILWELRKKFRCAVLKNKTVDF    701 - 770
SEIGEQVTSLITYGAMNRQEYVPVLLLVDDFEEQDNVYLLQYSIQTAIAKKYIRYEKPLVIILNCMRSQN    771 - 840
PEKSARIPDSIAVIQQLSPKEQRAFELKLKEIKEQHKNFEDFYSFMIMKTNFNKEYIENVVRNILKGQNI    841 - 910
FTKEAKLFSFLALLNSYVPDTTISLSQCEKFLGIGNKKAFWGTEKFEDKMGTYSTILIKTEVIECGNYCG    911 - 980
VRIIHSLIAEFSLEELKKSYHLNKSQIMLDMLTENLFFDTGMGKSKFLQDMHTLLLTRHRDEHEGETGNW    981 - 1050
FSPFIEALHKDEGNEAVEAVLLESIHRFNPNAFICQALARHFYIKKKDFGNALNWAKQAKIIEPDNSYIS   1051 - 1120
DTLGQVYKSKIRWWIEENGGNGNISVDDLIALLDLAEHASSAFKESQQQSEDREYEVKERLYPKSKRRYD   1121 - 1190
TYNIAGYQGEIEVGLYTIQILQLIPFFDNKNELSKRYMVNFVSGSSDIPGDPNNEYKLALKNYIPYLTKL   1191 - 1260
KFSLKKSFDFFDEYFVLLKPRNNIKQNEEAKTRRKVAGYFKKYVDIFCLLEESQNNTGLGSKFSEPLQVE   1261 - 1330
RCRRNLVALKADKFSGLLEYLIKSQEDAISTMKCIVNEYTFLLEQCTVKIQSKEKLNFILANIILSCIQP   1331 - 1400
TSRLVKPVEKLKDQLREVLQPIGLTYQFSEPYFLASLLFWPENQQLDQHSEQMKEYAQALKNSFKGQYKH   1401 - 1470
MHRTKQPIAYFFLGKGKRLERLVHKGKIDQCFKKTPDINSLWQSGDVWKEEKVQELLLRLQGRAENNCLY   1471 - 1540
IEYGINEKITIPITPAFLGQLRSGRSIEKVSFYLGFSIGGPLAYDIEIV                        1541 - 1589
//

Text Mined References (24)

PMID Year Title