Property Summary

NCBI Gene PubMed Count 13
Grant Count 8
R01 Count 5
Funding $456,393.1
PubMed Score 5.63
PubTator Score 7.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26548558 we resequenced the SLC27A3 and SLC27A4 genes using 267 autism spectrum disorders(ASD) patient and 1140 control samples and detected 47 and 30 variants for the SLC27A3 and SLC27A4, revealing that they are highly polymorphic with multiple rare variants.
24893952 Our findings indicate that the lipid metabolism enzyme ACSVL3 is involved in GBM stem cell maintenance and the tumor-initiating capacity of GBM stem cell enriched-neurospheres in animals
23936004 all of 69 different lung tumors tested, including adeno-, squamous cell, large cell, and small cell carcinomas, had robustly elevated ACSVL3 levels.
20965718 Observational study of gene-disease association. (HuGE Navigator)
19920185 ACSVL3 maintains oncogenic properties of malignant glioma cells via a mechanism that involves, in part, the regulation of Akt function.

AA Sequence

MGVCQRTRAPWKEKSQLERAALGFRKGGSGMFASGWNQTVPIEEAGSMAALLLLPLLLLLPLLLLKLHLW      1 - 70
PQLRWLPADLAFAVRALCCKRALRARALAAAAADPEGPEGGCSLAWRLAELAQQRAAHTFLIHGSRRFSY     71 - 140
SEAERESNRAARAFLRALGWDWGPDGGDSGEGSAGEGERAAPGAGDAAAGSGAEFAGGDGAARGGGAAAP    141 - 210
LSPGATVALLLPAGPEFLWLWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGARALVLAPEFLESLEPDLP    211 - 280
ALRAMGLHLWAAGPGTHPAGISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARISHL    281 - 350
KILQCQGFYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQFWEDCQQHRVTVFQ    351 - 420
YIGELCRYLVNQPPSKAERGHKVRLAVGSGLRPDTWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGA    421 - 490
VGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLL    491 - 560
KDVFRPGDVFFNTGDLLVCDDQGFLRFHDRTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGVTVPGH    561 - 630
EGRAGMAALVLRPPHALDLMQLYTHVSENLPPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSTLSD    631 - 700
PLYVLDQAVGAYLPLTTARYSALLAGNLRI                                            701 - 730
//

Text Mined References (13)

PMID Year Title
26548558 2015 Investigation of the fatty acid transporter-encoding genes SLC27A3 and SLC27A4 in autism.
24893952 2014 Lipid metabolism enzyme ACSVL3 supports glioblastoma stem cell maintenance and tumorigenicity.
23936004 2013 Very long-chain acyl-CoA synthetase 3: overexpression and growth dependence in lung cancer.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
19946888 2010 Defining the membrane proteome of NK cells.
19920185 2009 Acyl-CoA synthetase VL3 knockdown inhibits human glioma cell proliferation and tumorigenicity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469937 2004 Mouse very long-chain Acyl-CoA synthetase 3/fatty acid transport protein 3 catalyzes fatty acid activation but not fatty acid transport in MA-10 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...