Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.30
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.077 0.000
non-inflammatory breast cancer -2.300 0.009

Gene RIF (1)

PMID Text
15536082 analysis of post-translational processing mechanisms of polyserase-2 revealed that this novel polyprotein is a secreted enzyme whose three protease domains remain as an integral part of a single polypeptide chain

AA Sequence

MARHLLLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLHHGGGH      1 - 70
ICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADL     71 - 140
ALLRLASPASLGPAVWPVCLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLY    141 - 210
SQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVA    211 - 280
TYEAWIREQVMGSEPGPAFPTQPQKTQSDPQEPREENCTIALPECGKAPRPGAWPWEAQVMVPGSRPCHG    281 - 350
ALVSESWVLAPASCFLDPNSSDSPPRDLDAWRVLLPSRPRAERVARLVQHENASWDNASDLALLQLRTPV    351 - 420
NLSAASRPVCLPHPEHYFLPGSRCRLARWGRGEPALGPGALLEAELLGGWWCHCLYGRQGAAVPLPGDPP    421 - 490
HALCPAYQEKEEVGSCWNDSRWSLLCQEEGTWFLAGIRDFPSGCLRPRAFFPLQTHGPWISHVTRGAYLE    491 - 560
DQLAWDWGPDGEETETQTCPPHTEHGACGLRLEAAPVGVLWPWLAEVHVAGDRVCTGILLAPGWVLAATH    561 - 630
CVLRPGSTTVPYIEVYLGRAGASSLPQGHQVSRLVISIRLPQHLGLRPPLALLELSSRVEPSPSALPICL    631 - 700
HPAGIPPGASCWVLGWKEPQDRVPVAAAVSILTQRICDCLYQGILPPGTLCVLYAEGQENRCEMTSAPPL    701 - 770
LCQMTEGSWILVGMAVQGSRELFAAIGPEEAWISQTVGEANFLPPSGSPHWPTGGSNLCPPELAKASGSP    771 - 840
HAVYFLLLLTLLIQS                                                           841 - 855
//

Text Mined References (7)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15536082 2005 Human polyserase-2, a novel enzyme with three tandem serine protease domains in a single polypeptide chain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.