Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.76
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (9)

PMID Text
22899580 the level of CLLU1 mRNA expression provided prognostic information in patients with CLL.
22738889 Analysis of CLLU1 expression is a rapid and reliable tool that may facilitate the diagnosis of mature B-cell neoplasms especially in inconclusive cases.
21323738 Assessment of blood CLLU1 levels can be used as a reliable marker of tumor burden and has the potential to complement currently used techniques for minimal residual disease monitoring in patients with chronic lymphocytic leukemia.
19726446 CLLU1 is a novel human-specific protein-coding gene.
19212335 The CLLU1 expression level is a stable and inherent feature of the chronic lymphocytic leukemia clone
18457263 CLLU1 expression was significantly associated with clinical stage and CD38 expression in chronic lymphocytic leukemia.
17786715 The expression levels of CLLU1 were significantly increased in B + C CLL patients at Binet stage compared with those at Binet stage A (P = 0.005).
17284524 CLLU1 has a role in progression of chronic lymphocytic leukemia
16339396 CLLU1 is the first disease-specific gene identified in chronic lymphocytic leukemia.

AA Sequence

MFNKCSFHSSIYRPAADNSASSLCAIICFLNLVIECDLETNSEINKLIIYLFSQNNRIRFSKLLLKILFY      1 - 70
ISIFSYPELMCEQYVTFIKPGIHYGQVSKKHIIYSTFLSKNFKFQLLRVCW                        71 - 121
//

Text Mined References (11)

PMID Year Title
22922567 2013 450K-array analysis of chronic lymphocytic leukemia cells reveals global DNA methylation to be relatively stable over time and similar in resting and proliferative compartments.
22899580 2013 CLLU1 expression has prognostic value in chronic lymphocytic leukemia after first-line therapy in younger patients and in those with mutated IGHV genes.
22738889 2012 CLLU1 expression distinguishes chronic lymphocytic leukemia from other mature B-cell neoplasms.
21323738 2011 Analysis of CLLU1 expression levels before and after therapy in patients with chronic lymphocytic leukemia.
19726446 2009 Recent de novo origin of human protein-coding genes.
19212335 2009 The CLLU1 expression level is a stable and inherent feature of the chronic lymphocytic leukemia clone.
18457263 2007 [Expression of CLLU1 in patients with chronic lymphocytic leukemia and its prognostic significance].
17786715 2007 The prognostic evaluation of CLLU1 expression levels in 50 Chinese patients with chronic lymphocytic leukemia.
17284524 2007 CLLU1 expression analysis adds prognostic information to risk prediction in chronic lymphocytic leukemia.
16529606 2006 CLLU1 expression levels predict time to initiation of therapy and overall survival in chronic lymphocytic leukemia.
More...