Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.96
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.1e-27

Gene RIF (9)

AA Sequence

MFNKCSFHSSIYRPAADNSASSLCAIICFLNLVIECDLETNSEINKLIIYLFSQNNRIRFSKLLLKILFY      1 - 70
ISIFSYPELMCEQYVTFIKPGIHYGQVSKKHIIYSTFLSKNFKFQLLRVCW                        71 - 121
//

Text Mined References (20)

PMID Year Title