Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession Q5K130
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MNKLGHNELKECLKTATDSLQTVQPSISQTCTSYGPALGAPLPGRNEVALLTSLPPNYEISEGKPRAISA      1 - 70
YVRAGKGNVTRRRKKTHLGNDDGKKEAQEKM                                            71 - 101
//

Text Mined References (1)

PMID Year Title
16339396 2006 Identification of a gene on chromosome 12q22 uniquely overexpressed in chronic lymphocytic leukemia.