Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
R01 Count 4
Funding $164,445.5
PubMed Score 9.51
PubTator Score 9.69

Knowledge Summary

Patent (4,554)

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -1.100 0.000
intraductal papillary-mucinous carcinoma... 1.500 0.013
pediatric high grade glioma -1.100 0.000
pilocytic astrocytoma -1.300 0.000
posterior fossa group A ependymoma -1.200 0.000
lung adenocarcinoma 1.100 0.000
ovarian cancer 1.300 0.000
pituitary cancer 1.700 0.000

Gene RIF (5)

PMID Text
24946238 Ephrin receptor A10 is a promising drug target potentially useful for breast cancers including triple negative breast cancers
24924629 Therefore, the idea was conceived that the overexpression of EphA10 in prostate cancers might have a potential as a target for prostate cancer therapy, and formed the basis for the studies reported here.
24403271 EphA10 expression at both the gene and protein level in clinical breast cancer tissues is significantly associated with lymph node metastasis as well as stage progression.
21737611 EPHA10 does not interact with EPHB6 in breast neoplasms
18819711 CLL B-cells showed a more heterogeneous Eph/EFN profile, specially EFNA4, EphB6 and EphA10.

AA Sequence

METCAGPHPLRLFLCRMQLCLALLLGPWRPGTAEEVILLDSKASQAELGWTALPSNGWEEISGVDEHDRP      1 - 70
IRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGAAGTCKETFNVYYLETEADLGRG     71 - 140
RPRLGGSRPRKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRRGFHLAFQDVGACVALVSVRVYYKQ    141 - 210
CRATVRGLATFPATAAESAFSTLVEVAGTCVAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAGFQERGD    211 - 280
FCEACPPGFYKVSPRRPLCSPCPEHSRALENASTFCVCQDSYARSPTDPPSASCTRPPSAPRDLQYSLSR    281 - 350
SPLVLRLRWLPPADSGGRSDVTYSLLCLRCGREGPAGACEPCGPRVAFLPRQAGLRERAATLLHLRPGAR    351 - 420
YTVRVAALNGVSGPAAAAGTTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEY    421 - 490
EIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAASPGPSWEAQSFNPSIEVQTLGEAASGSR    491 - 560
DQSPAIVVTVVTISALLVLGSVMSVLAIWRRPCSYGKGGGDAHDEEELYFHFKVPTRRTFLDPQSCGDLL    561 - 630
QAVHLFAKELDAKSVTLERSLGGGRFGELCCGCLQLPGRQELLVAVHMLRDSASDSQRLGFLAEALTLGQ    631 - 700
FDHSHIVRLEGVVTRGSTLMIVTEYMSHGALDGFLRRHEGQLVAGQLMGLLPGLASAMKYLSEMGYVHRG    701 - 770
LAARHVLVSSDLVCKISGFGRGPRDRSEAVYTTMSGRSPALWAAPETLQFGHFSSASDVWSFGIIMWEVM    771 - 840
AFGERPYWDMSGQDVIKAVEDGFRLPPPRNCPNLLHRLMLDCWQKDPGERPRFSQIHSILSKMVQDPEPP    841 - 910
KCALTTCPRPPTPLADRAFSTFPSFGSVGAWLEALDLCRYKDSFAAAGYGSLEAVAEMTAQDLVSLGISL    911 - 980
AEHREALLSGISALQARVLQLQGQGVQV                                              981 - 1008
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24946238 2014 Ephrin receptor A10 is a promising drug target potentially useful for breast cancers including triple negative breast cancers.
24924629 2014 Eph receptor A10 has a potential as a target for a prostate cancer therapy.
24403271 2013 Expression of Eph receptor A10 is correlated with lymph node metastasis and stage progression in breast cancer patients.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21737611 A paradigm shift in EPH receptor interaction: biological relevance of EPHB6 interaction with EPHA2 and EPHB2 in breast carcinoma cell lines.
18819711 2009 Expression profile of Eph receptors and ephrin ligands in healthy human B lymphocytes and chronic lymphocytic leukemia B-cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
More...