Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.10
PubTator Score 9.69

Knowledge Summary

Patent (4,554)

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 3.9e-09
glioblastoma -1.100 7.1e-05
intraductal papillary-mucinous carcinoma... 1.500 1.3e-02
lung adenocarcinoma 1.100 4.8e-07
ovarian cancer 1.300 3.0e-07
pediatric high grade glioma -1.100 4.5e-07
pituitary cancer 1.700 3.8e-06
posterior fossa group A ependymoma -1.200 1.8e-12

Gene RIF (6)

AA Sequence

METCAGPHPLRLFLCRMQLCLALLLGPWRPGTAEEVILLDSKASQAELGWTALPSNGWEEISGVDEHDRP      1 - 70
IRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGAAGTCKETFNVYYLETEADLGRG     71 - 140
RPRLGGSRPRKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRRGFHLAFQDVGACVALVSVRVYYKQ    141 - 210
CRATVRGLATFPATAAESAFSTLVEVAGTCVAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAGFQERGD    211 - 280
FCEACPPGFYKVSPRRPLCSPCPEHSRALENASTFCVCQDSYARSPTDPPSASCTRPPSAPRDLQYSLSR    281 - 350
SPLVLRLRWLPPADSGGRSDVTYSLLCLRCGREGPAGACEPCGPRVAFLPRQAGLRERAATLLHLRPGAR    351 - 420
YTVRVAALNGVSGPAAAAGTTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEY    421 - 490
EIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAASPGPSWEAQSFNPSIEVQTLGEAASGSR    491 - 560
DQSPAIVVTVVTISALLVLGSVMSVLAIWRRPCSYGKGGGDAHDEEELYFHFKVPTRRTFLDPQSCGDLL    561 - 630
QAVHLFAKELDAKSVTLERSLGGGRFGELCCGCLQLPGRQELLVAVHMLRDSASDSQRLGFLAEALTLGQ    631 - 700
FDHSHIVRLEGVVTRGSTLMIVTEYMSHGALDGFLRRHEGQLVAGQLMGLLPGLASAMKYLSEMGYVHRG    701 - 770
LAARHVLVSSDLVCKISGFGRGPRDRSEAVYTTMSGRSPALWAAPETLQFGHFSSASDVWSFGIIMWEVM    771 - 840
AFGERPYWDMSGQDVIKAVEDGFRLPPPRNCPNLLHRLMLDCWQKDPGERPRFSQIHSILSKMVQDPEPP    841 - 910
KCALTTCPRPPTPLADRAFSTFPSFGSVGAWLEALDLCRYKDSFAAAGYGSLEAVAEMTAQDLVSLGISL    911 - 980
AEHREALLSGISALQARVLQLQGQGVQV                                              981 - 1008
//

Text Mined References (16)

PMID Year Title