Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.3e-03
glioblastoma 1.200 3.6e-03
medulloblastoma, large-cell 1.500 3.7e-04

Synonym

Accession Q5JXX7 Q8NHR4
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRLTEKSEGEQQLKPNNSNAPNEDQEEEIQQSEQHTPARQRTQRADTQPSRCRLPSRRTPTTSSDRTINL      1 - 70
LEVLPWPTEWIFNPYRLPALFELYPEFLLVFKEAFHDISHCLKAQMEKIGLPIILHLFALSTLYFYKFFL     71 - 140
PTILSLSFFILLVLLLLLFIIVFILIFF                                              141 - 168
//

Text Mined References (4)

PMID Year Title