Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.95
PubTator Score 0.25

Knowledge Summary

Patent (362)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Pelizaeus-Merzbacher disease 20 3.999 2.0

Expression

AA Sequence

MTTLVPATLSFLLLWTLPGQVLLRVALAKEEVKSGTKGSQPMSPSDFLDKLMGRTSGYDARIRPNFKGPP      1 - 70
VNVTCNIFINSFSSITKTTMDYRVNVFLRQQWNDPRLSYREYPDDSLDLDPSMLDSIWKPDLFFANEKGA     71 - 140
NFHEVTTDNKLLRIFKNGNVLYSIRLTLILSCLMDLKNFPMDIQTCTMQLESFGYTMKDLVFEWLEDAPA    141 - 210
VQVAEGLTLPQFILRDEKDLGCCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWIN    211 - 280
MDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAINFVSRQHKEFI    281 - 350
RLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGGPMEGSGIYSPQPPAPLLREGETTRKLYVD       351 - 417
//

Text Mined References (4)

PMID Year Title
21282206 2011 Novel expression of a functional glycine receptor chloride channel that attenuates contraction in airway smooth muscle.
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.