Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.09
PubTator Score 11.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.100 1.2e-02
malignant mesothelioma 1.500 2.8e-06
osteosarcoma -1.269 8.4e-07
psoriasis 1.100 2.9e-04

Synonym

Accession Q5JXC2 C0KL22 Q96HU6 Q9H839 Q9HA00
Symbols IIP45

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

AA Sequence

MVEAEELAQLRLLNLELLRQLWVGQDAVRRSVARAASESSLESSSSYNSETPSTPETSSTSLSTSCPRGR      1 - 70
SSVWGPPDACRGDLRDVARSGVASLPPAKCQHQESLGRPRPHSAPSLGTSSLRDPEPSGRLGDPGPQEAQ     71 - 140
TPRSILAQQSKLSKPRVTFSEESAVPKRSWRLRPYLGYDWIAGSLDTSSSITSQPEAFFSKLQEFRETNK    141 - 210
EECICSHPEPQLPGLRESSGSGVEEDHECVYCYRVNRRLFPVPVDPGTPCRLCRTPRDQQGPGTLAQPAH    211 - 280
VRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQK    281 - 350
LSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP                                    351 - 388
//

Text Mined References (18)

PMID Year Title