Property Summary

NCBI Gene PubMed Count 10
Grant Count 7
R01 Count 5
Funding $375,693.91
PubMed Score 13.91
PubTator Score 11.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis 1.100 0.000
osteosarcoma -1.269 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.012

Gene RIF (7)

PMID Text
26466362 HIV-1 Nef-mediated downregulation of HLA (MHCI) may be affected by/inhibited by' MIIP as demonstrated by siRNA genome-wide screen [in HeLa cells)
20418911 MIIP attenuates mitotic transition and increases mitotic catastrophe, thereby inhibiting glioma development and progression.
20103646 Results suggest MIIP K167E as a functional genetic marker of breast cancer development and prognosis.
20008322 Data show a novel mechanism by which IIp45 inhibits cell motility through inhibition of HDAC6.
19773279 Observational study of gene-disease association. (HuGE Navigator)
15867349 IIp45 gene is inactivated by a tumor-specific alternative splicing that generates an aberrant and unstable IIp45 isoform in infiltrative gliomas.
14617774 identified a gene, invasion inhibitory protein 45 (IIp45), whose protein product bound to IGFBP-2 through the thyroglobulin-RGD region of the C terminus of IGFBP-2

AA Sequence

MVEAEELAQLRLLNLELLRQLWVGQDAVRRSVARAASESSLESSSSYNSETPSTPETSSTSLSTSCPRGR      1 - 70
SSVWGPPDACRGDLRDVARSGVASLPPAKCQHQESLGRPRPHSAPSLGTSSLRDPEPSGRLGDPGPQEAQ     71 - 140
TPRSILAQQSKLSKPRVTFSEESAVPKRSWRLRPYLGYDWIAGSLDTSSSITSQPEAFFSKLQEFRETNK    141 - 210
EECICSHPEPQLPGLRESSGSGVEEDHECVYCYRVNRRLFPVPVDPGTPCRLCRTPRDQQGPGTLAQPAH    211 - 280
VRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQK    281 - 350
LSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP                                    351 - 388
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20418911 2010 Inhibition of gliomagenesis and attenuation of mitotic transition by MIIP.
20103646 2010 Definition of a functional single nucleotide polymorphism in the cell migration inhibitory gene MIIP that affects the risk of breast cancer.
20008322 2010 IIp45 inhibits cell migration through inhibition of HDAC6.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16901920 2006 IGF-independent effects of IGFBP-2 on the human breast cancer cell line Hs578T.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...