Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.56
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Migraine without Aura 11 3.804 1.9

AA Sequence

MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKV      1 - 70
RFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIET     71 - 140
ARAWTRLYAMNSI                                                             141 - 153
//

Text Mined References (4)

PMID Year Title