Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.56
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Migraine without aura 6 3.794 1.9
psoriasis 6,685

AA Sequence

MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKV      1 - 70
RFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIET     71 - 140
ARAWTRLYAMNSI                                                             141 - 153
//

Text Mined References (4)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
15772651 2005 The DNA sequence of the human X chromosome.