Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.56
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 5.66754828645141E-4
Disease Target Count Z-score Confidence
Migraine without aura 6 3.794 1.9

Synonym

Accession Q5JXB2 E9KL27
Symbols Li174

Gene

  Ortholog (2)

Species Source
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

AA Sequence

MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKV      1 - 70
RFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIET     71 - 140
ARAWTRLYAMNSI                                                             141 - 153
//

Text Mined References (4)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
15772651 2005 The DNA sequence of the human X chromosome.