Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.953 0.001
tuberculosis 2.200 0.000
lung carcinoma -1.100 0.000

Gene RIF (1)

PMID Text
17178844 Relationship between ATM kinase and extracellular signal-regulated kinase 1/2 (ERK1/2), a key mitogenic stimulator.

AA Sequence

MCSTMSAPTCLAHLPPCFLLLALVLVPSDASGQSSRNDWQVLQPEGPMLVAEGETLLLRCMVVGSCTDGM      1 - 70
IKWVKVSTQDQQEIYNFKRGSFPGVMPMIQRTSEPLNCDYSIYIHNVTREHTGTYHCVRFDGLSEHSEMK     71 - 140
SDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGDTVFLNCTVLGDGPPGPIRWFQGAGLSREAIYNFGGI    141 - 210
SHPKETAVQASNNDFSILLQNVSSEDAGTYYCVKFQRKPNRQYLSGQGTSLKVKAKSTSSKEAEFTSEPA    211 - 280
TEMSPTGLLVVFAPVVLGLKAITLAALLLALATSRRSPGQEDVKTTGPAGAMNTLAWSKGQE            281 - 342
//

Text Mined References (7)

PMID Year Title
23620142 2013 Genome-wide and gene-centric analyses of circulating myeloperoxidase levels in the charge and care consortia.
17178844 2006 Ataxia telangiectasia mutated down-regulates phospho-extracellular signal-regulated kinase 1/2 via activation of MKP-1 in response to radiation.
16691243 2006 The SIRP family of receptors and immune regulation.
16339511 2005 A nomenclature for signal regulatory protein family members.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12213963 2002 Identifying novel transcripts and novel genes in the human genome by using novel SAGE tags.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.