Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 6.1e-08

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.404 6.1e-08

Synonym

Accession Q5JX69 Q3KRB5
Symbols C20orf107
dJ1153D9.4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MWTLKSSLVLLLCLTCSYAFMFSSLRQKTSEPQGKVPCGEHFRIRQNLPEHTQGWLGSKWLWLLFAVVPF      1 - 70
VILQCQRDSEKNKEQSPPGLRGFPFRTPLKKNQNASLYKDCVFNTLNELEVELLKFVSEVQNLKGAMATG     71 - 140
SGSNLKLRRSEMPADPYHVTICKIWGEESSS                                           141 - 171
//

Text Mined References (7)

PMID Year Title