Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5JWF8 B9EH76
Symbols dJ63M2.2
C20orf134

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

MASTALLALCSTGAFSGLAVEAGAGVCHATPIYAGHSWHQATFRLNVAGSTLSRYLRDLLVAANPDLLQQ      1 - 70
ALPRKAITHLKKRSCYVSLDFEGDLRDPARHHPASFSVGNGCCVCLSSERFRCPEPIFQPGLLGQAEQGL     71 - 140
PALAFRALQKMPKTLRTRLADTVVLAGGSTLFPGFAERLDKELEAQCRRHGYAALRPHLVAKHGRGMAVW    141 - 210
TGGSMVASLHSFQRRWITRAMYQECGSRLLYDVFN                                       211 - 245
//

Text Mined References (3)

PMID Year Title