Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.42
PubTator Score 10.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.600 0.002
ependymoma -1.800 0.003
oligodendroglioma -1.600 0.008
psoriasis -1.500 0.018
glioblastoma -1.900 0.000
group 4 medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.500 0.000
tuberculosis -1.100 0.000
lung cancer 1.800 0.000
breast carcinoma -1.300 0.000
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.518 0.034
invasive ductal carcinoma -1.200 0.004

Synonym

Accession Q5JVS0 O75804 Q8WV33 Q9NYJ2 IHABP-4
Symbols IHABP4
IHABP-4
Ki-1/57
SERBP1L

Gene

Gene RIF (9)

PMID Text
21771594 Ki-1/57 may be involved in translational regulation
20551049 Observational study of gene-disease association. (HuGE Navigator)
20436279 Ki-1/57 is localized to several subnuclear domains, all of which have been described to splicing and other RNA processing events.
19523114 Findings suggest that Ki-1/57 is probably involved in cellular events related to RNA functions, such as pre-mRNA splicing.
18788774 Data suggest that Ki-1/57 has characteristics of an intrinsically unstructured protein, which may explain its functional plasticity.
16879614 Has two conserved Gly/Arg-rich motif clusters (RGG/RXR box, where X is any amino acid) that may be substrates for arginine-methylation by PRMT1.
15862299 MEF2C DNA-binding activity is inhibited through its interaction with Ki-1/57.
14699138 association of Ki-1/57 with the RACK1/PKC pathway and may be important for the regulation of its cellular functions
12505151 interacts with the C-terminal region of the human chromatin-remodeling factor CHD-3

AA Sequence

MKGALGSPVAAAGAAMQESFGCVVANRFHQLLDDESDPFDILREAERRRQQQLQRKRRDEAAAAAGAGPR      1 - 70
GGRSPAGASGHRAGAGGRRESQKERKSLPAPVAQRPDSPGGGLQAPGQKRTPRRGEQQGWNDSRGPEGML     71 - 140
ERAERRSYREYRPYETERQADFTAEKFPDEKPGDRFDRDRPLRGRGGPRGGMRGRGRGGPGNRVFDAFDQ    141 - 210
RGKREFERYGGNDKIAVRTEDNMGGCGVRTWGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPEL    211 - 280
EVEEETQVQEMTLDEWKNLQEQTRPKPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFRKPA    281 - 350
NDITSQLEINFGNLPRPGRGARGGTRGGRGRIRRAENYGPRAEVVMQDVAPNPDDPEDFPALS           351 - 413
//

Text Mined References (27)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21771594 2011 Evidence for the association of the human regulatory protein Ki-1/57 with the translational machinery.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20551049 2010 Confirmation of linkage to and localization of familial colon cancer risk haplotype on chromosome 9q22.
20436279 From protein interaction profile to functional assignment: the human protein Ki-1/57 is associated with pre-mRNA splicing events.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19523114 2009 Functional association of human Ki-1/57 with pre-mRNA splicing events.
18788774 2008 Human regulatory protein Ki-1/57 has characteristics of an intrinsically unstructured protein.
More...