Property Summary

NCBI Gene PubMed Count 21
PubMed Score 11.05
PubTator Score 10.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.600 5.7e-07
astrocytic glioma -1.600 1.9e-03
Astrocytoma, Pilocytic -1.100 8.4e-07
atypical teratoid / rhabdoid tumor -1.200 2.7e-06
breast carcinoma -1.300 3.6e-04
ependymoma -1.800 3.5e-03
glioblastoma -1.300 5.0e-09
group 3 medulloblastoma -1.200 1.9e-04
invasive ductal carcinoma -1.200 4.3e-03
lung cancer 1.800 1.6e-04
medulloblastoma, large-cell -2.100 7.2e-06
oligodendroglioma -1.600 8.1e-03
primitive neuroectodermal tumor -1.100 1.3e-04
psoriasis -1.500 1.8e-02
subependymal giant cell astrocytoma -1.518 3.4e-02
tuberculosis -1.100 2.6e-05

 GO Function (1)

Gene RIF (9)

AA Sequence

MKGALGSPVAAAGAAMQESFGCVVANRFHQLLDDESDPFDILREAERRRQQQLQRKRRDEAAAAAGAGPR      1 - 70
GGRSPAGASGHRAGAGGRRESQKERKSLPAPVAQRPDSPGGGLQAPGQKRTPRRGEQQGWNDSRGPEGML     71 - 140
ERAERRSYREYRPYETERQADFTAEKFPDEKPGDRFDRDRPLRGRGGPRGGMRGRGRGGPGNRVFDAFDQ    141 - 210
RGKREFERYGGNDKIAVRTEDNMGGCGVRTWGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPEL    211 - 280
EVEEETQVQEMTLDEWKNLQEQTRPKPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFRKPA    281 - 350
NDITSQLEINFGNLPRPGRGARGGTRGGRGRIRRAENYGPRAEVVMQDVAPNPDDPEDFPALS           351 - 413
//

Text Mined References (27)

PMID Year Title