Property Summary

NCBI Gene PubMed Count 36
PubMed Score 45.93
PubTator Score 50.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.300 2.9e-03
astrocytic glioma 2.900 1.3e-03
Astrocytoma, Pilocytic 1.200 3.9e-06
atypical teratoid / rhabdoid tumor 1.100 1.4e-02
chronic rhinosinusitis -1.633 2.2e-02
cutaneous lupus erythematosus -1.300 8.0e-04
ependymoma 3.000 3.2e-02
glioblastoma 2.000 1.5e-03
group 3 medulloblastoma 2.100 3.6e-06
intraductal papillary-mucinous adenoma (... 1.500 5.5e-04
intraductal papillary-mucinous carcinoma... 1.300 1.2e-02
lung cancer 1.100 4.9e-02
nasopharyngeal carcinoma -1.600 2.7e-03
non-small cell lung cancer -1.027 3.9e-06
oligodendroglioma 2.700 1.3e-02
osteosarcoma 2.028 1.1e-03
ovarian cancer -2.500 5.8e-08
Pick disease 1.200 5.9e-04
primitive neuroectodermal tumor 1.100 4.5e-02
psoriasis -1.100 1.7e-04
tuberculosis and treatment for 6 months 1.200 7.0e-05

Gene RIF (25)

AA Sequence

MVSNPVHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAP      1 - 70
VLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVEN     71 - 140
SGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALD    141 - 210
PYTELRKQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHE    211 - 280
RNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPF    281 - 350
TRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVL    351 - 420
RYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDF    421 - 490
FIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELE    491 - 560
ALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMCSHGEGKIN    561 - 630
YYNFVRAFSN                                                                631 - 640
//

Text Mined References (36)

PMID Year Title