Property Summary

NCBI Gene PubMed Count 7
PubMed Score 140.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 7.5e-18
Disease Target Count Z-score Confidence
Henoch-Schoenlein purpura 12 3.261 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.100 7.5e-18

AA Sequence

MKTPFGKAAAGQRSRTGAGHGSVSVTMIKRKAAHKKHRSRPTSQPRGNIVGCRIQHGWKDGDEPLTQWKG      1 - 70
TVLDQVPVNPSLYLIKYDGFDCVYGLELHRDERVSSLEVLPNRVASSRISDTHLAEIMVGKAVEHIFETE     71 - 140
EGSKNEWRGMVLAQAPVMNTWFYITYEKDPVLYMYQLLDDYKDGDLRILQDSNDSPLAEREPGEVIDSLV    141 - 210
GKQVEYAKDDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS                          211 - 258
//

Text Mined References (8)

PMID Year Title