Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.26
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 1.400 1.8e-05
pancreatic ductal adenocarcinoma liver m... -1.115 4.6e-03
pituitary cancer 1.100 1.3e-05
tuberculosis and treatment for 3 months -1.100 4.9e-07

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MSHTEVKLKIPFGNKLLDAVCLVPNKSLTYGIILTHGASGDMNLPHLMSLASHLASHGFFCLRFTCKGLN      1 - 70
IVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQ     71 - 140
HKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRSTNDVFKEINT    141 - 210
QILFWIQEITEMDKKCH                                                         211 - 227
//

Text Mined References (7)

PMID Year Title