Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.26
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis and treatment for 3 months 327 4.90829111124551E-7
pituitary cancer 1972 1.29155541260836E-5
Breast cancer 3099 1.82391210658627E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00460441203938794
Disease Target Count Z-score Confidence
Rectal neoplasm 7 3.939 2.0
Rectum cancer 12 3.214 1.6

Expression

  Differential Expression (4)

Synonym

Accession Q5JUR7 Q5JUR8 Q96KZ8
Symbols C13orf27

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MSHTEVKLKIPFGNKLLDAVCLVPNKSLTYGIILTHGASGDMNLPHLMSLASHLASHGFFCLRFTCKGLN      1 - 70
IVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQ     71 - 140
HKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRSTNDVFKEINT    141 - 210
QILFWIQEITEMDKKCH                                                         211 - 227
//

Text Mined References (7)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.