Property Summary

NCBI Gene PubMed Count 5
Grant Count 151
R01 Count 79
Funding $13,952,984.34
PubMed Score 3.33

Knowledge Summary

Patent

No data available

Synonym

Accession Q5JUK9 A5D6Y1 PAGE-3
Symbols CT16.6
GAGED1
PAGE-3

Gene

 Compartment GO Term (1)

AA Sequence

MSGHQRTRSRSRERRDDQDSNHPVGAVVAQELPSNDQLQQEEPPIESQDYTPGQERDEGALDFQVLGLAA      1 - 70
YLWELTRSKTGGERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV                                71 - 113
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9724777 1998 PAGE-1, an X chromosome-linked GAGE-like gene that is expressed in normal and neoplastic prostate, testis, and uterus.