Property Summary

NCBI Gene PubMed Count 41
PubMed Score 0.56
PubTator Score 12.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.3e-06
group 3 medulloblastoma 4104 1.3e-03
Disease Target Count Z-score Confidence
Sickle Cell Anemia 53 3.96 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.3e-03
osteosarcoma -1.302 1.3e-06

Gene RIF (23)

AA Sequence

MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALV      1 - 70
VKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKK     71 - 140
DLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFISNTGGKQINQVAL    141 - 210
EAWRSRRDREEILLQELEPVISRAVLDNPHHGFSNSGIMEERLLDAVVPFLPLQRHHVRHCVLNELAQLG    211 - 280
LEPRDEVVQAVLDSTTFFPEDEQLFSSNGCKTVASRIAFFL                                 281 - 321
//

Text Mined References (41)

PMID Year Title