Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.100 1.2e-03
chronic rhinosinusitis -1.522 3.0e-02
ependymoma 1.200 3.9e-04
nasopharyngeal carcinoma -1.200 3.9e-07

AA Sequence

MAPKKSVSKAGKELEVKKKGGKKEPVVAVEPPLAKEMKEFYHIQIRDLEDRLARYQRKWDELAVQEKMFR      1 - 70
QEFEQLANNKKEIVAFLKRTLNQQVDEITDLNEQLQNLQLAKEMEKDAFEAQLAQVRHEFQETKDQLTTE     71 - 140
NIILGGKLAALEEFRLQKEEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVAN    141 - 210
EFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQLKGRQNNLCKQLELLENTQKVMARHK    211 - 280
RGHQKIILMLTKKCQEQQQDTKEAEELRLLLSQLEQRSLQLQVDNQALKSQRDQLSLQLEQQQVDLQRLQ    281 - 350
QELANEQKVRASLEAALVQATSFLQNILQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSSTVATRPQKAA    351 - 420
CPHQESQSHGPPKESRPSIQLPRTGSLLPQLSDITPYQPGDLGLVPRQVHIPPNPQDLRLLSYITRVGTF    421 - 490
RAHSSPEMRAPGSLKRLEKFSLPEVPLRPK                                            491 - 520
//

Text Mined References (5)

PMID Year Title