Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.10175049020064E-14
nasopharyngeal carcinoma 1056 3.85075554090322E-7
adult high grade glioma 2148 0.00119350698763174
chronic rhinosinusitis 512 0.0301398274628763

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 3.800 0.000
adult high grade glioma 1.100 0.001
nasopharyngeal carcinoma -1.200 0.000
chronic rhinosinusitis -1.522 0.030

Synonym

Accession Q5JU67 A5D8T9
Symbols C9orf117

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG
Xenopus OMA EggNOG

AA Sequence

MAPKKSVSKAGKELEVKKKGGKKEPVVAVEPPLAKEMKEFYHIQIRDLEDRLARYQRKWDELAVQEKMFR      1 - 70
QEFEQLANNKKEIVAFLKRTLNQQVDEITDLNEQLQNLQLAKEMEKDAFEAQLAQVRHEFQETKDQLTTE     71 - 140
NIILGGKLAALEEFRLQKEEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVAN    141 - 210
EFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQLKGRQNNLCKQLELLENTQKVMARHK    211 - 280
RGHQKIILMLTKKCQEQQQDTKEAEELRLLLSQLEQRSLQLQVDNQALKSQRDQLSLQLEQQQVDLQRLQ    281 - 350
QELANEQKVRASLEAALVQATSFLQNILQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSSTVATRPQKAA    351 - 420
CPHQESQSHGPPKESRPSIQLPRTGSLLPQLSDITPYQPGDLGLVPRQVHIPPNPQDLRLLSYITRVGTF    421 - 490
RAHSSPEMRAPGSLKRLEKFSLPEVPLRPK                                            491 - 520
//

Text Mined References (5)

PMID Year Title
23300604 2012 Transcriptional program of ciliated epithelial cells reveals new cilium and centrosome components and links to human disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.