Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 7.99524221080106E-30
non-small cell lung cancer 2798 2.03347294005616E-9
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.68952997525969E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.46829494553117E-4
pancreatic cancer 2300 2.61316525684739E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0022541195093376
ulcerative colitis 2087 0.00644091752734532
interstitial cystitis 2299 0.0127151094352068
ductal carcinoma in situ 1745 0.0142667259642747
invasive ductal carcinoma 2950 0.0302241948547475

Expression

AA Sequence

MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPA      1 - 70
PAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHH     71 - 140
RGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRS    141 - 210
GKPAYYPFPQRKTPRISQAARNLGLYGSA                                             211 - 239
//

Text Mined References (4)

PMID Year Title
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.