Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5JTY5 B4DNG9 Q6VB91
Symbols bA561O23.1

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MLPAVGSVDEEEDPAEEDCPELVPIETTQSEEEEKSGLGAKIPVTIITGYLGAGKTTLLNYILTEQHSKR      1 - 70
VAVILNESGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLRAIENLMQKKGKFDDILLETTGL     71 - 140
ADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADIILINKTDLVPE    141 - 210
EDVKKLRTTIRSINGLGQILETQRSRVDLSNVLDLHAFDSLSGISLQKKLQHVPGTQPHLDQSIVTITFE    211 - 280
VPGNAKEEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDD    281 - 350
TERTNRLVLIGRNLDKDILKQLFIATVTETEKQWTTHFKEDQVCT                             351 - 395
//

Text Mined References (6)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15233989 2004 Diverse fates of paralogs following segmental duplication of telomeric genes.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421752 2002 Gene content and function of the ancestral chromosome fusion site in human chromosome 2q13-2q14.1 and paralogous regions.