Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.87
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
CONE-ROD DYSTROPHY AND HEARING LOSS 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
cone-rod dystrophy 59 3.218 1.6
Disease Target Count Z-score Confidence
Usher syndrome 32 3.85 1.9
Sensorineural hearing loss 106 3.085 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.9e-07
group 3 medulloblastoma 1.200 1.6e-04
Hydrolethalus syndrome -1.104 2.9e-02
primitive neuroectodermal tumor 1.300 3.3e-04
tuberculosis 1.200 5.4e-04

Gene RIF (6)

AA Sequence

MIDSVKLRRDSAADFFSHYEYLCALQNSVPLPAVRACLREGVLDFNADRLRGVDWAPLLSTLKINKDLPL      1 - 70
VSIKSFFQPWLGDTGSDMNKFCRSRVPAIRYKDVTFQLCKALKGCLSISSVLKNLELNGLILRERDLTIL     71 - 140
AKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSITLKTVNFTGCNLTWQGADHMAKILKYQTMRRHEE    141 - 210
TWAESLRYRRPDLDCMAGLRRITLNCNTLIGDLGACAFADSLSEDLWLRALDLQQCGLTNEGAKALLEAL    211 - 280
ETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKG    281 - 350
KATIRIGLATKKPVSSGRKHSLGKEYYAPAPLPPGVSGFLPWRTAERAKRHRGFPLIKTRDICNQLQQPG    351 - 420
FPVTVTVESPSSSEVEEVDDSSESVHEVPEKTSIEQEALQEKLEECLKQLKEERVIRLKVDKRVSELEHE    421 - 490
NAQLRNINFSLSEALHAQSLTNMILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQSDFQLL    491 - 560
GHPQMTSTVSNPPKEEKKALEDEKPEPKQNALGQMQNIQFQKITGDARIPLPLDSFPVPVSTPEGLGTSS    561 - 630
NNLGVPATEQRQESFEGFIARMCSPSPDATSGTGSQRKEEELSRNSRSSSEKKTKTESH               631 - 689
//

Text Mined References (24)

PMID Year Title