Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.39
PubTator Score 44.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (11)

Disease log2 FC p
aldosterone-producing adenoma -1.799 6.9e-03
Breast cancer 2.900 4.3e-02
ependymoma 1.100 5.7e-08
invasive ductal carcinoma -1.162 6.4e-03
lung cancer -1.200 6.2e-03
medulloblastoma, large-cell -1.500 1.8e-04
Multiple myeloma 1.885 2.1e-03
oligodendroglioma 1.200 7.8e-03
osteosarcoma -1.596 1.4e-06
ovarian cancer -2.400 6.4e-08
Waldenstrons macroglobulinemia 1.307 4.5e-02

Gene RIF (6)

AA Sequence

MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFSDEPPEVYGDF      1 - 70
EPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPL     71 - 140
QPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQ    141 - 210
KVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLS    211 - 280
SGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASG    281 - 350
SFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEE    351 - 420
ALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHRFESFPAGSTL    421 - 490
IFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGL    491 - 560
WSRISHLVLPVQPENALKRGICL                                                   561 - 583
//

Text Mined References (35)

PMID Year Title