Property Summary

NCBI Gene PubMed Count 20
Grant Count 55
R01 Count 17
Funding $4,401,715.66
PubMed Score 11.38
PubTator Score 44.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.307 0.045
Multiple myeloma 1.885 0.002
oligodendroglioma 1.200 0.008
osteosarcoma 3.521 0.000
ependymoma 1.400 0.000
medulloblastoma, large-cell -1.500 0.000
lung cancer -1.200 0.006
Breast cancer 2.900 0.043
aldosterone-producing adenoma -1.799 0.007
invasive ductal carcinoma -1.162 0.006
ovarian cancer -2.400 0.000

Gene RIF (6)

PMID Text
25323962 LAP1 co-localizes with acetylated alpha-tubulin in the mitotic spindle and with gamma-tubulin in centrosomes (main microtubule organizing center) in mitotic cells.
25149450 Data show that mutation of arginine 563 in lamina-associated polypeptide 1 (LAP1) reduces its ability to stimulate TorsinA ATPase hydrolysis.
24856141 study described a new autosomal recessive nuclear envelope disease caused by a homozygous mutation in exon 1 of TOR1AIP1 encoding LAP1B; study expands the spectrum of genes associated with nuclear envelopathies and highlights critical function for LAP1B in striated muscle
24116158 Data indicate that the protein phosphatase 1 (PP1) binding domain in nuclear membrane protein lamina associated polypeptide 1B (LAP1B) was here identified as the REVRF motif at amino acids 55-59.
19454010 Interaction of HIV-1 Tat with lamina-associated polypeptide 1B in T-cells is identified by a proteomic strategy based on affinity chromatography
12061773 Molecular cloning of LAP1B & the role of the protein domains in localization of LAP1B to nuclear and endoplasmic reticulum membranes was determined

AA Sequence

MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFSDEPPEVYGDF      1 - 70
EPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPL     71 - 140
QPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQ    141 - 210
KVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLS    211 - 280
SGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASG    281 - 350
SFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEE    351 - 420
ALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHRFESFPAGSTL    421 - 490
IFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGL    491 - 560
WSRISHLVLPVQPENALKRGICL                                                   561 - 583
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25323962 2015 LAP1 is a crucial protein for the maintenance of the nuclear envelope structure and cell cycle progression.
25149450 2014 How lamina-associated polypeptide 1 (LAP1) activates Torsin.
24856141 2014 Mutation in TOR1AIP1 encoding LAP1B in a form of muscular dystrophy: a novel gene related to nuclear envelopathies.
24275647 2014 Arresting a Torsin ATPase reshapes the endoplasmic reticulum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116158 2013 The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate.
23569223 2013 Regulation of Torsin ATPases by LAP1 and LULL1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365922 2012 Interactions between the ROP18 kinase and host cell proteins that aid in the parasitism of Toxoplasma gondii.
More...