Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.38
PubTator Score 44.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ependymoma 2514 9.0694466311348E-9
osteosarcoma 7933 2.05878981937554E-8
ovarian cancer 8492 6.40211919514934E-8
medulloblastoma, large-cell 6234 1.81600917796997E-4
Multiple myeloma 1328 0.00210344889655775
lung cancer 4473 0.00619805973582159
invasive ductal carcinoma 2950 0.00642712792760875
aldosterone-producing adenoma 664 0.00687670194406204
oligodendroglioma 2849 0.00781551250023927
Breast cancer 3099 0.0432354870396386
Waldenstrons macroglobulinemia 765 0.0446783309243706
Disease Target Count Z-score Confidence
limb-girdle muscular dystrophy 36 0.0 4.0
Disease Target Count Z-score Confidence
Dystonia 77 3.651 1.8
Muscular dystrophy 48 3.607 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.307 0.045
Multiple myeloma 1.885 0.002
oligodendroglioma 1.200 0.008
osteosarcoma 3.521 0.000
ependymoma 1.400 0.000
medulloblastoma, large-cell -1.500 0.000
lung cancer -1.200 0.006
Breast cancer 2.900 0.043
aldosterone-producing adenoma -1.799 0.007
invasive ductal carcinoma -1.162 0.006
ovarian cancer -2.400 0.000

Synonym

Accession Q5JTV8 A8K630 B0QZ57 Q5JTV6 Q8IZ65 Q9H8Y6 Q9HAJ1 Q9NV52 Q9Y3X5
Symbols LAP1
LAP1B
LGMD2Y

Gene

PDB

4TVS  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid

Pathway (1)

Gene RIF (6)

PMID Text
25323962 LAP1 co-localizes with acetylated alpha-tubulin in the mitotic spindle and with gamma-tubulin in centrosomes (main microtubule organizing center) in mitotic cells.
25149450 Data show that mutation of arginine 563 in lamina-associated polypeptide 1 (LAP1) reduces its ability to stimulate TorsinA ATPase hydrolysis.
24856141 study described a new autosomal recessive nuclear envelope disease caused by a homozygous mutation in exon 1 of TOR1AIP1 encoding LAP1B; study expands the spectrum of genes associated with nuclear envelopathies and highlights critical function for LAP1B in striated muscle
24116158 Data indicate that the protein phosphatase 1 (PP1) binding domain in nuclear membrane protein lamina associated polypeptide 1B (LAP1B) was here identified as the REVRF motif at amino acids 55-59.
19454010 Interaction of HIV-1 Tat with lamina-associated polypeptide 1B in T-cells is identified by a proteomic strategy based on affinity chromatography
12061773 Molecular cloning of LAP1B & the role of the protein domains in localization of LAP1B to nuclear and endoplasmic reticulum membranes was determined

AA Sequence

MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFSDEPPEVYGDF      1 - 70
EPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPL     71 - 140
QPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQ    141 - 210
KVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLS    211 - 280
SGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASG    281 - 350
SFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEE    351 - 420
ALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHRFESFPAGSTL    421 - 490
IFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGL    491 - 560
WSRISHLVLPVQPENALKRGICL                                                   561 - 583
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25323962 2015 LAP1 is a crucial protein for the maintenance of the nuclear envelope structure and cell cycle progression.
25149450 2014 How lamina-associated polypeptide 1 (LAP1) activates Torsin.
24856141 2014 Mutation in TOR1AIP1 encoding LAP1B in a form of muscular dystrophy: a novel gene related to nuclear envelopathies.
24275647 2014 Arresting a Torsin ATPase reshapes the endoplasmic reticulum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116158 2013 The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate.
23569223 2013 Regulation of Torsin ATPases by LAP1 and LULL1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365922 2012 Interactions between the ROP18 kinase and host cell proteins that aid in the parasitism of Toxoplasma gondii.
More...