Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 1.7e-07
ependymoma 4679 2.1e-06
lung carcinoma 2843 7.5e-04
diabetes mellitus 1728 1.3e-03

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.200 1.3e-03
ependymoma 2.100 2.1e-06
lung carcinoma -1.400 7.5e-04
nasopharyngeal carcinoma -1.500 1.7e-07

AA Sequence

MNSGVPATLAVRRVKFFGQHGGEVNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCR      1 - 70
FSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQLASGGWDKRVMLWDVQSGQML     71 - 140
RLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIWDLRMVTPAVSHQALEGHSANISCLCYSASGLLASGS    141 - 210
WDKTIHIWKPTTSSLLIQLKGHVTWVKSIAFSPDELWLASAGYSRMVKVWDCNTGKCLETLKGVLDVAHT    211 - 280
CAFTPDGKILVSGAADQTRRQISRTSKSPRDPQT                                        281 - 314
//

Text Mined References (3)

PMID Year Title