Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 3.400 0.000
diabetes mellitus 1.200 0.001
nasopharyngeal carcinoma -1.500 0.000
lung carcinoma -1.400 0.001

Synonym

Accession Q5JTN6 A0PK24
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MNSGVPATLAVRRVKFFGQHGGEVNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCR      1 - 70
FSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQLASGGWDKRVMLWDVQSGQML     71 - 140
RLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIWDLRMVTPAVSHQALEGHSANISCLCYSASGLLASGS    141 - 210
WDKTIHIWKPTTSSLLIQLKGHVTWVKSIAFSPDELWLASAGYSRMVKVWDCNTGKCLETLKGVLDVAHT    211 - 280
CAFTPDGKILVSGAADQTRRQISRTSKSPRDPQT                                        281 - 314
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.