Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.22
PubTator Score 5.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.200 3.6e-06
breast carcinoma 1.500 2.7e-04
intraductal papillary-mucinous neoplasm ... 1.200 2.5e-02
invasive ductal carcinoma 1.100 2.0e-03
non-small cell lung cancer 1.017 1.6e-11
ovarian cancer 1.900 6.1e-05

Gene RIF (6)

AA Sequence

MGPGGPLLSPSRGFLLCKTGWHSNRLLGDCGPHTPVSTALSFIAVGMAAPSMKERQVCWGARDEYWKCLD      1 - 70
ENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS                    71 - 125
//

Text Mined References (22)

PMID Year Title