Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 8.45708940572036E-32
astrocytoma 1493 4.5807982840334E-29
oligodendroglioma 2849 3.85799268720808E-20
pilocytic astrocytoma 3086 3.56586363051153E-6
sonic hedgehog group medulloblastoma 1482 1.95979818098194E-5
adult high grade glioma 2148 3.78720216424496E-5
medulloblastoma, large-cell 6234 2.34584533252699E-4
atypical teratoid / rhabdoid tumor 4369 0.00127548495833883
invasive ductal carcinoma 2950 0.024698658376289

Expression

  Differential Expression (9)

Synonym

Accession Q5JTD7
Symbols C6orf154

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQLNLNLGVVSS      1 - 70
PSRIKQLAEALRTNRSIQSLFLHGSPLTDAGLALLNPALALHPALVALDLGDCMLGDEAINLICGLLPPD     71 - 140
GAKSGLKELTLSANPGITPKGWSRLAIAVAHSSQVRVLNLDYNPLGDHVAGMLAVAVASSRTLEVLDLEG    141 - 210
TGLTNQSAQTLLDMVENYPTALRSLVLAENSISPELQQQICDLLSEGEEEEEVAGGAGDTQEWERGREPA    211 - 280
AHQRGSSSWMCPSDPSSQMVLMTSGLGDSLLAETEM                                      281 - 316
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.