Property Summary

NCBI Gene PubMed Count 10
PubMed Score 75.91
PubTator Score 18.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 7.0e-06
osteosarcoma 7950 4.3e-05
Pick disease 1894 4.0e-04
diabetes mellitus 1728 2.4e-03
progressive supranuclear palsy 676 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Gonorrhea 13 4.368 2.2
Giardiasis 9 3.47 1.7
Legionnaires' disease 20 3.453 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus 2.300 2.4e-03
osteosarcoma -1.614 4.3e-05
Pick disease -1.400 4.0e-04
progressive supranuclear palsy -1.300 2.2e-02
psoriasis -2.400 7.0e-06

AA Sequence

MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENEELRRRLASATRRTEALEREL      1 - 70
EIGQDCLELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLASLSHSWIFAIKKAEMDRKTL     71 - 140
DWEIVELTNKLLDAKNTINKLEELNERYRLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQ    141 - 210
EAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQSGSAGRPLAEDVFVHVDMSEGVPGDPASPPAP    211 - 280
GSPTPQPNGECHSLGTARGSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNC    281 - 350
TYATRQAISLSLVEEGSERARPSPVPSTPASAQASPHHQPSPAPLTLSAPASSASSEEDLLVSWQRAFVD    351 - 420
RTPPPAAVAQRTAFGRDALPELQRHFAHSPADRDEVVQAPSARPEESELLLPTEPDSGFPREEEELNLPI    421 - 490
SPEEERQSLLPINRGTEEGPGTSHTEGRAWPLPSSSRPQRSPKRMGVHHLHRKDSLTQAQEQGNLLN       491 - 557
//

Text Mined References (21)

PMID Year Title