Property Summary

NCBI Gene PubMed Count 41
PubMed Score 456.01
PubTator Score 68.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
Breast cancer 3099 3.44060053207577E-5
osteosarcoma 7933 7.59688107564158E-5
group 3 medulloblastoma 2254 0.00280179411347074
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Nephroblastoma 45 5.492 2.7
Premature ovarian failure 64 3.311 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.349 0.000
group 3 medulloblastoma 1.100 0.003
Breast cancer 1.100 0.000

Synonym

Accession Q5JTC6 A2IB86 Q8N885 Amer1
Symbols WTX
OSCS
FAM123B

Gene

PDB

4YJE   4YJL   4YK6  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Chicken OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (32)

PMID Text
26071483 Losses of AMER1 by other mechanisms apart from mutations.
24459086 A nonsense mutation (c.1045C>T, p.Glu349*) in the WTX gene.
24265322 Data show that beta-arrestins regulate Wnt3a-induced low density lipoprotein receptor-related protein 6 (Lrp6) phosphorylation by the regulation of the membrane dynamics of Amer1.
24249259 WTX inactivation occurs in a wider variety of tumor types than previously appreciated and point to shared pathogenic mechanisms between a subset of pediatric malignancies.
23333300 Stat3 inhibits WTX expression through up-regulation of micro RNA-370 in Wilms tumor.
22800892 WTX mutations occur early in Wilms' tumor development, but at a low proportion. There was no evidence that WTX is the main cause of Wilms' tumor.
22716240 Osteopathia striata with cranial sclerosis or Horan-Beighton syndrome is a rare X-linked dominant inherited bone dysplasia. Genetic analysis allowed the identification of maternally transmitted heterozygous nonsense c.1057C>T (p.R353X) WTX mutation.
22670894 Data indicate that osteopathia striata congenita with cranial sclerosis (OSCS) iscaused by germline deletions of in the X-linked gene WTX (FAM123B, AMER1).
22285752 WTX modulates p53 function, in part through regulation of its activator CBP/p300.
22215675 WTX and NRF2 compete for binding to KEAP1, and thus loss of WTX leads to rapid ubiquitination and degradation of NRF2 and a reduced response to cytotoxic insult.
More...

AA Sequence

METQKDEAAQAKGAAASGSTREQTAEKGAKNKAAEATEGPTSEPSSSGPGRLKKTAMKLFGGKKGICTLP      1 - 70
SFFGGGRSKGSGKGSSKKGLSKSKTHDGLSEAAHGPEDVVSEGTGFSLPLPELPCQFPSSQSAHGALETG     71 - 140
SRCKTSVAGATEKAVAEKFPSMPKPKKGLKGFFSSIRRHRKSKVTGAEQSEPGAKGPERVRARPHEHVSS    141 - 210
APQVPCFEETFQAPRKENANPQDAPGPKVSPTPEPSPPATEKMACKDPEKPMEACASAHVQPKPAPEASS    211 - 280
LEEPHSPETGEKVVAGEVNPPNGPVGDPLSLLFGDVTSLKSFDSLTGCGDIIAEQDMDSMTDSMASGGQR    281 - 350
ANRDGTKRSSCLVTYQGGGEEMALPDDDDEEEEEEEEVELEEEEEEVKEEEEDDDLEYLWETAQMYPRPN    351 - 420
MNLGYHPTTSPGHHGYMLLDPVRSYPGLAPGELLTPQSDQQESAPNSDEGYYDSTTPGFEDDSGEALGLV    421 - 490
RRDCLPRDSYSGDALYEFYEPDDSLENSPPGDDCLYDLHGRSSEMFDPFLNFEPFLSSRPPGAMETEEER    491 - 560
LVTIQKQLLYWELRREQLEAQEARAREAHAREAHAREAYTREAYGREAYAREAHTWEAHGREARTREAQA    561 - 630
REVRCRETQVRETQARQEKPVLEYQMRPLGPSVMGLAAGVSGTSQISHRGITSAFPTTASSEPDWRDFRP    631 - 700
LEKRYEGTCSKKDQSTCLMQLFQSDAMFEPDMQEANFGGSPRRAYPTYSPPEDPEEEEVEKEGNATVSFS    701 - 770
QALVEFTSNGNLFSSMSCSSDSDSSFTQNLPELPPMVTFDIADVERDGEGKCEENPEFHNDEDLAASLEA    771 - 840
FELGYYHKHAFNNYHSRFYQGLPWGVSSLPRYLGLPGLHPRPPPAAMALNRRSRSLDTAETLEMELSNSH    841 - 910
LVQGYLESDELQAQQEDSDEEDEEEEEGEWSRDSPLSLYTEPPGAYDWPAWAPCPLPVGPGPAWISPNQL    911 - 980
DRPSSQSPYRQATCCIPPMTMSISLSVPESRAPGESGPQLARPSHLHLPMGPCYNLQPQASQSMRARPRD    981 - 1050
VLLPVDEPSCSSSSGGFSPSPLPQAKPVGITHGIPQLPRVRPEHPQPQPTHYGPSSLDLSKERAEQGASL   1051 - 1120
ATSYSSTAMNGNLAK                                                          1121 - 1135
//

Text Mined References (47)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26071483 2015 Exome Sequencing Reveals AMER1 as a Frequently Mutated Gene in Colorectal Cancer.
24459086 2014 A novel WTX mutation in a female patient with osteopathia striata with cranial sclerosis and hepatoblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24265322 2014 ?-arrestin promotes Wnt-induced low density lipoprotein receptor-related protein 6 (Lrp6) phosphorylation via increased membrane recruitment of Amer1 protein.
24251807 2014 Adenomatous polyposis coli (APC) membrane recruitment 3, a member of the APC membrane recruitment family of APC-binding proteins, is a positive regulator of Wnt-?-catenin signalling.
24249259 2014 Inactivation of the tumor suppressor WTX in a subset of pediatric tumors.
23333300 2013 Stat3 inhibits WTX expression through up-regulation of microRNA-370 in Wilms tumor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23092983 2012 Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
More...