Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.73
PubTator Score 2.26

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGL      1 - 70
LGLLEELAWNLPPGPFSPAPDLLGDGF                                                71 - 97
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12758124 2003 Plac8 and Plac9, novel placental-enriched genes identified through microarray analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.