Property Summary

NCBI Gene PubMed Count 23
Grant Count 5
R01 Count 5
Funding $288,032.99
PubMed Score 16.85
PubTator Score 16.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 3.500 0.000

Gene RIF (16)

PMID Text
27107895 Enhanced KLF17 expression sensitizes ERalpha-positive breast cancer cells to endocrine therapy.KLF17-ERalpha interaction plays a potential role in inhibition of ERalpha-dependent breast cancer progression.
26617836 Suggest that KLF17 inhibits esophageal carcinoma development and may serve as a potential therapeutic target.
25911104 Tumor-suppressive p53 signaling is critical for KLF17 to inhibit cancer metastasis in Non-small Cell Lung Cancer.
25766320 KLF17 empowers TGF-beta/Smad signaling by targeting Smad3-dependent pathway to suppress tumor growth and metastasis during cancer progression.
25706482 A small subset of Myoepithelial tumors harbor FUS rearrangements, two thirds of them being associated with KLF17 fusion.
25652467 In this review, we focus on the functions, roles, and regulatory networks of these five KLFs in HCC, summarize key pathways, and propose areas for further investigation
25111898 mutant p53 enhances cancer progression by inhibiting KLF17 expression in invasive breast carcinoma cells
25109837 The reduced expression of KLF17 promoted the motility and proliferation ability of TPC1 cells by altering the expression of tight junction protein 1 and Snai1, and activating the AKT pathway by upregulating inhibitor of DNA binding 1.
24947617 The reduced expression of KLF17 protein in gastric cancer was correlated with tumor size, pN stage and lymphovascular invasion and was an independent predictor for poor survival in patients undergoing surgery for gastric cancer.
24504364 KLF17 might be one of the downstream signalling molecules of DJ-1.
More...

AA Sequence

MYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPSIQHFPHSAEMLGS      1 - 70
PLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQEMTIFSGPQLMPVGEPNI     71 - 140
PRVARPFGGNLRMPPNGLPVSASTGIPIMSHTGNPPVPYPGLSTVPSDETLLGPTVPSTEAQAVLPSMAQ    141 - 210
MLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEA    211 - 280
RPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSR    281 - 350
EFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP                                   351 - 389
//

Text Mined References (23)

PMID Year Title
27107895 2016 KLF17 attenuates estrogen receptor ?-mediated signaling by impeding ER? function on chromatin and determines response to endocrine therapy.
26617836 2015 Low expression of KLF17 is associated with tumor invasion in esophageal carcinoma.
25911104 2015 Tumor-suppressive p53 Signaling Empowers Metastatic Inhibitor KLF17-dependent Transcription to Overcome Tumorigenesis in Non-small Cell Lung Cancer.
25766320 2015 KLF17 empowers TGF-?/Smad signaling by targeting Smad3-dependent pathway to suppress tumor growth and metastasis during cancer progression.
25706482 2015 Novel FUS-KLF17 and EWSR1-KLF17 fusions in myoepithelial tumors.
25652467 2015 Krüppel-like factors in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25111898 2014 Gain-of-function of mutant p53: mutant p53 enhances cancer progression by inhibiting KLF17 expression in invasive breast carcinoma cells.
25109837 2014 Suppressed Krüppel?like factor 17 expression induces tumor proliferation, metastasis and a poor prognosis in papillary thyroid carcinoma.
24947617 2014 Reduced Krüppel-like factor 17 (KLF17) expression correlates with poor survival in patients with gastric cancer.
More...