Property Summary

NCBI Gene PubMed Count 23
PubMed Score 18.79
PubTator Score 16.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 2.7e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Van der Woude syndrome 9 3.008 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 3.500 2.7e-08

Gene RIF (16)

AA Sequence

MYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPSIQHFPHSAEMLGS      1 - 70
PLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQEMTIFSGPQLMPVGEPNI     71 - 140
PRVARPFGGNLRMPPNGLPVSASTGIPIMSHTGNPPVPYPGLSTVPSDETLLGPTVPSTEAQAVLPSMAQ    141 - 210
MLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEA    211 - 280
RPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSR    281 - 350
EFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP                                   351 - 389
//

Text Mined References (23)

PMID Year Title