Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5JT78
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MALKTSLGSVQFMEQFCWPHLRSFCETCVGSWSIQMRQHHHQSSFPGSLPQETNLTLKVCKPQAPQKLDP      1 - 70
TLSSCFFIESCGAQVPVEGSRRETSITV                                               71 - 98
//

Text Mined References (1)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.