Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5JT25 Q17RQ0
Symbols

Gene

Gene RIF (1)

PMID Text
23936529 distinctive Rab41 effects on Golgi organization, ER-to-Golgi trafficking and cell growth

AA Sequence

MSAFGHDEAWMEAGGFGLEAAERTEYQSLCKSKLLFLGEQSVGKTSIISRFMYNSFGCACQATVGIDFLS      1 - 70
KTMYLEDQIVQLQLWDTAGQERFHSLIPSYIRDSTIAVVVYDITNINSFKETDKWVEHVRAERGDDVVIM     71 - 140
LLGNKIDLDNKRQVTAEQGEEKSRNLNVMFIETSAKTGYNVKKLFRRVASALLSTRTSPPPKEGTVEIEL    141 - 210
ESFEESGNRSYC                                                              211 - 222
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23936529 2013 Rab41 is a novel regulator of Golgi apparatus organization that is needed for ER-to-Golgi trafficking and cell growth.
16086013 2005 A GTPase-activating protein controls Rab5 function in endocytic trafficking.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15018353 2003 Isolation, expression pattern of a novel human RAB gene RAB41 and characterization of its intronless homolog RAB41P.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11697911 2001 Evolution of the Rab family of small GTP-binding proteins.