Property Summary

NCBI Gene PubMed Count 3
Grant Count 8
R01 Count 8
Funding $780,550.5
PubMed Score 1.11
PubTator Score 2.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 0.000

AA Sequence

MASSDVKPKSVSHAKKWSEEIENLYRFQQAGYRDETEYRQVKQVSMVDRWPETGYVKKLQRRDNTFYYYN      1 - 70
KQRECDDKEVHKVKIYAY                                                         71 - 88
//

Text Mined References (4)

PMID Year Title
23258628 2013 Germ cell-specific disruption of the Meig1 gene causes impaired spermiogenesis in mice.
19805151 2009 MEIG1 is essential for spermiogenesis in mice.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.