Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.84
PubTator Score 2.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.100 1.2e-03
non-small cell lung cancer -1.298 6.5e-17
osteosarcoma -2.503 1.3e-06
ovarian cancer -1.100 1.8e-07
subependymal giant cell astrocytoma 1.966 7.0e-03
ulcerative colitis 1.100 3.0e-04

Gene RIF (1)

AA Sequence

MESGRGSSTPPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIGPTGELSGSLK      1 - 70
IPNRDSGIDSPSSSVAGENFPCEEGLEAGPSPTVLGAHAEMALDSQVPKVTPQEEADSDVGEEPDSENTP     71 - 140
QKADKDAGLAQHSGPQKLLHIAQELLHTEETYVKRLHLLDQVFCTRLTDAGIPPEVIMGIFSNISSIHRF    141 - 210
HGQFLLPELKTRITEEWDTNPRLGDILQKLAPFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVVHSIQK    211 - 280
QEVCGNLTLQHHMLEPVQRVPRYELLLKDYLKRLPQDAPDRKDAERSLELISTAANHSNAAIRKVEKMHK    281 - 350
LLEVYEQLGGEEDIVNPANELIKEGQIQKLSAKNGTPQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD    351 - 420
ISGLQVQDIVKPNTAHTFIITGRKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKAFGGAFSQDED    421 - 490
PSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKSCGETFNSITKRRHHCKLCGA    491 - 560
VICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTEKTPTADPQPSLLCGPLRLSESGETWSEVWAAIPMS    561 - 630
DPQVLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHVWKLQWAKQSWYLSASSAELQQQWLETLST    631 - 700
AAHGDTAQDSPGALQLQVPMGAAAP                                                 701 - 725
//

Text Mined References (16)

PMID Year Title