Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.32
PubTator Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis -1.389 4.7e-02
Breast cancer -2.200 6.1e-11
intraductal papillary-mucinous neoplasm ... 1.200 2.8e-02
osteosarcoma -1.483 2.2e-04
ovarian cancer -2.200 2.2e-14
posterior fossa group B ependymoma 1.200 6.8e-06

AA Sequence

MPILLFLIDTSASMNQRTDLGTSYLDIAKGAVELFLKLRARDPASRGDRYMLVTYDEPPYCIKAGWKENH      1 - 70
ATFMSELKNLQASGLTTLGQALRSSFDLLNLNRLISGIDNYGQGRNPFFLEPSILITITDGNKLTSTAGV     71 - 140
QEELHLPLNSPLPGSELTKEPFRWDQRLFALVLRLPGVASTEPEQLGSVPTDESAITQMCEVTGGRSYCV    141 - 210
RTQRMLNQCLESLVQKVQSGVVINFEKTGPDPLPIGEDGLMDSSRPSNSFAAQPWHSCHKLIYVRPNSKT    211 - 280
GVPVGHWPIPESFWPDQNLPSLPPRTSHPVVRFSCVDCEPMVIDKLPFDKYELEPSPLTQYILERKSPHT    281 - 350
CWQVFVTSSGKYNELGYPFGYLKASTTLTCVNLFVMPYNYPVLLPLLDDLFKVHKLKPNLKWRQAFDSYL    351 - 420
KTLPPYYLLTKLESERILASVGKKPPQEIGIKVKNHSGGGMSLTHNKNFRKLLKEITGETALRLTELNTK    421 - 490
EFAGFQIGLLNKDLKPQTYRNAYDIPRRGLLDQLTRMRSNLLKTHKFIVGQDEDSLHSVPVAQMGNYQEY    491 - 560
LKTLASPLREIDPDQPKRLHTFGNPFKQDKKGMMIDEADEFVAGPQNKVKRPGEPNSPMSSKRRRSMSLL    561 - 630
LRKPQTPPTVTNHVGGKGPPSASWFPSYPNLIKPTLVHTDATIIHDGHEEKMENGQITPDGFLSKSAPSE    631 - 700
LINMTGDLMPPNQVDSLSDDFTSLSKDGLIQKPGSNAFVGGAKNCSLSVDDQKDPVASTLGAMPNTLQIT    701 - 770
PAMAQGINADIKHQLMKEVRKFGRKYERIFILLEEVQGPLEMKKQFVEFTIKEAARFKRRVLIQYLEKVL    771 - 840
EKINSHHLHNNISHINSRSSC                                                     841 - 861
//

Text Mined References (10)

PMID Year Title