Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.92
PubTator Score 4.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Bladder Neoplasm 109
Disease Target Count P-value
lung carcinoma 2844 7.55764624883547E-31
pilocytic astrocytoma 3086 1.87778037174369E-9
osteosarcoma 7933 7.41436622818663E-9
psoriasis 6685 3.0558418108698E-8
atypical teratoid/rhabdoid tumor 1095 3.36346530595442E-8
pediatric high grade glioma 2712 6.83643468451034E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 4.564625622993E-5
ulcerative colitis 2087 7.06473648527441E-5
interstitial cystitis 2299 9.09416031179124E-5
Pick disease 1893 1.69371430245385E-4
sonic hedgehog group medulloblastoma 1482 6.08331415374577E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 9.00332886004061E-4
glioblastoma 5572 9.54051992594844E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00103875272466686
medulloblastoma, large-cell 6234 0.00112313388840976
chronic lymphocytic leukemia 244 0.00333293392272679
subependymal giant cell astrocytoma 2287 0.00355770299899716

Expression

Synonym

Accession Q5JS13 B4DR86 E9PBQ5 O15059 Q5JT60 Q5JT65 Q5JUG5 Q8N4S6 Q8N5H4 Q8WUV7 Q9NZ16
Symbols RALGEF2
RALGPS1A

Gene

PDB

3QXL  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (4)

PMID Text
21494904 The guanine-nucleotide exchange factor (GEF) RalGPS1a activates small GTPase Ral proteins such as RalA and RalB by stimulating the exchange of Ral bound GDP to GTP, thus regulating various downstream cellular processes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQ      1 - 70
PEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHS     71 - 140
LMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDL    141 - 210
IYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNY    211 - 280
KLSLRIEPGSSSPRLVSSKEDLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNMMCQ    281 - 350
LSVVESKSATFPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLESPTGP    351 - 420
CICSLGNSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDRKHYKSTPGKK    421 - 490
VSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQVPANLMSFE       491 - 557
//

Text Mined References (15)

PMID Year Title
21494904 2011 Structural study of the Cdc25 domain from Ral-specific guanine-nucleotide exchange factor RalGPS1a.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...