Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 7.000 0.000
astrocytic glioma 2.200 0.039
psoriasis -2.000 0.000
glioblastoma 2.300 0.000
oligodendroglioma 1.300 0.000
cystic fibrosis -1.379 0.000
medulloblastoma, large-cell -1.900 0.020
Atopic dermatitis -2.600 0.000
non-small cell lung cancer -1.123 0.000
lung cancer -1.100 0.004
pediatric high grade glioma 2.300 0.008
pilocytic astrocytoma 3.300 0.000
sonic hedgehog group medulloblastoma -1.600 0.027
lung carcinoma -1.300 0.000
breast carcinoma -1.300 0.000
Breast cancer -3.900 0.000
ductal carcinoma in situ -1.400 0.017
ovarian cancer -5.700 0.000

AA Sequence

MHQSLTQQRSSDMSLPDSMGAFNRRKRNSIYVTVTLLIVSVLILTVGLAATTRTQNVTVGGYYPGVILGF      1 - 70
GSFLGIIGSNLIENKRQMLVASIVFISFGVIAAFCCAIVDGVFAARHIDLKPLYANRCHYVPKTSQKEAE     71 - 140
EVISSSTKNSPSTRVMRNLTQAAREVNCPHLSREFCTPRIRGNTCFCCDLYNCGNRVEITGGYYEYIDVS    141 - 210
SCQDIIHLYHLLWSATILNIVGLFLGIITAAVLGGFKDMNPTLPALNCSVENTHPTVSYYAHPQVASYNT    211 - 280
YYHSPPHLPPYSAYDFQHSGVFPSSPPSGLSDEPQSASPSPSYMWSSSAPPRYSPPYYPPFEKPPPYSP     281 - 349
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.