Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 2.100 1.1e-03
astrocytic glioma 2.200 3.9e-02
Astrocytoma, Pilocytic 3.300 1.6e-08
Atopic dermatitis -2.600 6.4e-05
Breast cancer -3.900 7.1e-62
breast carcinoma -1.300 9.4e-14
cystic fibrosis -1.379 2.4e-05
ductal carcinoma in situ -1.400 1.7e-02
glioblastoma 2.300 2.3e-04
lung cancer -1.100 4.0e-03
lung carcinoma -1.300 6.3e-14
malignant mesothelioma 7.000 4.7e-09
medulloblastoma, large-cell -1.900 2.0e-02
non-small cell lung cancer -1.123 4.0e-07
oligodendroglioma 1.300 1.4e-04
ovarian cancer -5.700 5.5e-17
psoriasis -1.600 1.4e-06
sonic hedgehog group medulloblastoma -1.600 2.7e-02

AA Sequence

MHQSLTQQRSSDMSLPDSMGAFNRRKRNSIYVTVTLLIVSVLILTVGLAATTRTQNVTVGGYYPGVILGF      1 - 70
GSFLGIIGSNLIENKRQMLVASIVFISFGVIAAFCCAIVDGVFAARHIDLKPLYANRCHYVPKTSQKEAE     71 - 140
EVISSSTKNSPSTRVMRNLTQAAREVNCPHLSREFCTPRIRGNTCFCCDLYNCGNRVEITGGYYEYIDVS    141 - 210
SCQDIIHLYHLLWSATILNIVGLFLGIITAAVLGGFKDMNPTLPALNCSVENTHPTVSYYAHPQVASYNT    211 - 280
YYHSPPHLPPYSAYDFQHSGVFPSSPPSGLSDEPQSASPSPSYMWSSSAPPRYSPPYYPPFEKPPPYSP     281 - 349
//

Text Mined References (5)

PMID Year Title