Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.90013351467951E-95
Breast cancer 3099 7.14892344501634E-62
ovarian cancer 8492 5.51069659491446E-17
lung carcinoma 2844 6.25640079332563E-14
breast carcinoma 1614 9.42443344223851E-14
malignant mesothelioma 3163 4.7214430121253E-9
pilocytic astrocytoma 3086 1.17893221332698E-8
non-small cell lung cancer 2798 4.01747865536528E-7
cystic fibrosis 1670 2.35620752198572E-5
Atopic dermatitis 944 6.3745585465637E-5
oligodendroglioma 2849 1.3731173460474E-4
glioblastoma 5572 2.29474683387639E-4
lung cancer 4473 0.00401109140887969
pediatric high grade glioma 2712 0.00799015336682896
ductal carcinoma in situ 1745 0.0165850962825114
medulloblastoma, large-cell 6234 0.0202162504027477
sonic hedgehog group medulloblastoma 1482 0.027461842956714
astrocytic glioma 2241 0.039312612900105

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 7.000 0.000
astrocytic glioma 2.200 0.039
psoriasis -2.000 0.000
glioblastoma 2.300 0.000
oligodendroglioma 1.300 0.000
cystic fibrosis -1.379 0.000
medulloblastoma, large-cell -1.900 0.020
Atopic dermatitis -2.600 0.000
non-small cell lung cancer -1.123 0.000
lung cancer -1.100 0.004
pediatric high grade glioma 2.300 0.008
pilocytic astrocytoma 3.300 0.000
sonic hedgehog group medulloblastoma -1.600 0.027
lung carcinoma -1.300 0.000
breast carcinoma -1.300 0.000
Breast cancer -3.900 0.000
ductal carcinoma in situ -1.400 0.017
ovarian cancer -5.700 0.000

Synonym

Accession Q5JRV8 A8K0W9 B1APR4 B3KPI6 E9PAR3 Q86Y72 Q9NWN8
Symbols FAM70A

Gene

  Ortholog (9)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Zebrafish OMA EggNOG

AA Sequence

MHQSLTQQRSSDMSLPDSMGAFNRRKRNSIYVTVTLLIVSVLILTVGLAATTRTQNVTVGGYYPGVILGF      1 - 70
GSFLGIIGSNLIENKRQMLVASIVFISFGVIAAFCCAIVDGVFAARHIDLKPLYANRCHYVPKTSQKEAE     71 - 140
EVISSSTKNSPSTRVMRNLTQAAREVNCPHLSREFCTPRIRGNTCFCCDLYNCGNRVEITGGYYEYIDVS    141 - 210
SCQDIIHLYHLLWSATILNIVGLFLGIITAAVLGGFKDMNPTLPALNCSVENTHPTVSYYAHPQVASYNT    211 - 280
YYHSPPHLPPYSAYDFQHSGVFPSSPPSGLSDEPQSASPSPSYMWSSSAPPRYSPPYYPPFEKPPPYSP     281 - 349
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.