Property Summary

NCBI Gene PubMed Count 3
Grant Count 5
R01 Count 1
Funding $617,711.83
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.009 0.023
diabetes mellitus 1.200 0.001

Synonym

Accession Q5JRK9 A1L414
Symbols CT16.5
GAGEE3
PAGE-2B

Gene

 Compartment GO Term (1)

AA Sequence

MSEHVRTRSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENEGAPAVQGPDMEA      1 - 70
FQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP                                  71 - 111
//

Text Mined References (4)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.