Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-03
osteosarcoma 7950 2.3e-02
Disease Target Count Z-score Confidence
Delusional disorder 13 5.164 2.6
Schizoaffective Disorder 55 3.716 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.200 1.4e-03
osteosarcoma -2.009 2.3e-02

AA Sequence

MSEHVRTRSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENEGAPAVQGPDMEA      1 - 70
FQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP                                  71 - 111
//

Text Mined References (4)

PMID Year Title