Property Summary

NCBI Gene PubMed Count 30
PubMed Score 21.74
PubTator Score 29.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 1.76631216652209E-6
medulloblastoma, large-cell 6234 5.30865077222793E-5
glioblastoma 5572 6.16687564733635E-5
ovarian cancer 8492 2.11604023526616E-4
atypical teratoid / rhabdoid tumor 4369 2.54134204760732E-4
lung cancer 4473 5.8043569015868E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0010445575786676
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00109036288421226
diabetes mellitus 1663 0.00126091237697871
group 4 medulloblastoma 1875 0.0024504236168584
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00609633028093883
Pick disease 1893 0.00960229846173489
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 1.0
Myocardial Infarction 126 0.0 2.0
Disease Target Count Z-score Confidence
Alcoholic neuropathy 4 4.216 2.1

Expression

Synonym

Accession Q5JRA6 A8K2S0 A8MT05 A8MT13 B7Z430 Q14083 Q3S4X3 Q5JRA5 Q5JRB0 Q5JRB1 Q5JRB2 Q6UVY8 Q86Y60 Q8N8M5 Q92580
Symbols ARNT
D320
TANGO
TANGO1
UNQ6077

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (15)

PMID Text
26568311 TANGO1 is thus pivotal in concentrating procollagen VII in the lumen and recruiting ERGIC membranes on the cytoplasmic surface of the endoplasmic reticulum.
24889917 TANGO expression was strongly associated with tumour progression, nodal metastasis, clinical stage and number of blood or lymph vessels in oral squamous cell carcinoma.
24125424 We conclude that SNP rs17465637 in MIA3 is indeed a genetic risk factor for CAD across different ethnic populations including Han Chinese.
22577832 results suggest a potential association of the MIA3 rs17465637 with cardiovascular disease in dyslipidemic patients with rheumatoid arthritis
21264445 genetic polymorphism is associated with an increased risk of myocardial infarction
20971364 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20694560 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19955471 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAAPGLLVWLLVLRLPWRVPGQLDPSTGRRFSEHKLCADDECSMLMYRGEALEDFTGPDCRFVNFKKGD      1 - 70
PVYVYYKLARGWPEVWAGSVGRTFGYFPKDLIQVVHEYTKEELQVPTDETDFVCFDGGRDDFHNYNVEEL     71 - 140
LGFLELYNSAATDSEKAVEKTLQDMEKNPELSKEREPEPEPVEANSEESDSVFSENTEDLQEQFTTQKHH    141 - 210
SHANSQANHAQGEQASFESFEEMLQDKLKVPESENNKTSNSSQVSNEQDKIDAYKLLKKEMTLDLKTKFG    211 - 280
STADALVSDDETTRLVTSLEDDFDEELDTEYYAVGKEDEENQEDFDELPLLTFTDGEDMKTPAKSGVEKY    281 - 350
PTDKEQNSNEEDKVQLTVPPGIKNDDKNILTTWGDTIFSIVTGGEETRDTMDLESSSSEEEKEDDDDALV    351 - 420
PDSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQDKTELEDENQ    421 - 490
EGMTVHSSVHSNNLNSMPAAEKGKDTLKSAYDDTENDLKGAAIHISKGMLHEEKPGEQILEGGSESESAQ    491 - 560
KAAGNQMNDRKIQQESLGSAPLMGDDHPNASRDSVEGDALVNGAKLHTLSVEHQREELKEELVLKTQNQP    561 - 630
RFSSPDEIDLPRELEDEVPILGRNLPWQQERDVAATASKQMSEKIRLSEGEAKEDSLDEEFFHHKAMQGT    631 - 700
EVGQTDQTDSTGGPAFLSKVEEDDYPSEELLEDENAINAKRSKEKNPGNQGRQFDVNLQVPDRAVLGTIH    701 - 770
PDPEIEESKQETSMILDSEKTSETAAKGVNTGGREPNTMVEKERPLADKKAQRPFERSDFSDSIKIQTPE    771 - 840
LGEVFQNKDSDYLKNDNPEEHLKTSGLAGEPEGELSKEDHENTEKYMGTESQGSAAAEPEDDSFHWTPHT    841 - 910
SVEPGHSDKREDLLIISSFFKEQQSLQRFQKYFNVHELEALLQEMSSKLKSAQQESLPYNMEKVLDKVFR    911 - 980
ASESQILSIAEKMLDTRVAENRDLGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEG    981 - 1050
LGGAMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVIGDTHASEVSQKPNTEKDLDPGPVTTEDTPM   1051 - 1120
DAIDANKQPETAAEEPASVTPLENAILLIYSFMFYLTKSLVATLPDDVQPGPDFYGLPWKPVFITAFLGI   1121 - 1190
ASFAIFLWRTVLVVKDRVYQVTEQQISEKLKTIMKENTELVQKLSNYEQKIKESKKHVQETRKQNMILSD   1191 - 1260
EAIKYKDKIKTLEKNQEILDDTAKNLRVMLESEREQNVKNQDLISENKKSIEKLKDVISMNASEFSEVQI   1261 - 1330
ALNEAKLSEEKVKSECHRVQEENARLKKKKEQLQQEIEDWSKLHAELSEQIKSFEKSQKDLEVALTHKDD   1331 - 1400
NINALTNCITQLNLLECESESEGQNKGGNDSDELANGEVGGDRNEKMKNQIKQMMDVSRTQTAISVVEED   1401 - 1470
LKLLQLKLRASVSTKCNLEDQVKKLEDDRNSLQAAKAGLEDECKTLRQKVEILNELYQQKEMALQKKLSQ   1471 - 1540
EEYERQEREHRLSAADEKAVSAAEEVKTYKRRIEEMEDELQKTERSFKNQIATHEKKAHENWLKARAAER   1541 - 1610
AIAEEKREAANLRHKLLELTQKMAMLQEEPVIVKPMPGKPNTQNPPRRGPLSQNGSFGPSPVSGGECSPP   1611 - 1680
LTVEPPVRPLSATLNRRDMPRSEFGSVDGPLPHPRWSAEASGKPSPSDPGSGTATMMNSSSRGSSPTRVL   1681 - 1750
DEGKVNMAPKGPPPFPGVPLMSTPMGGPVPPPIRYGPPPQLCGPFGPRPLPPPFGPGMRPPLGLREFAPG   1751 - 1820
VPPGRRDLPLHPRGFLPGHAPFRPLGSLGPREYFIPGTRLPPPTHGPQEYPPPPAVRDLLPSGSRDEPPP   1821 - 1890
ASQSTSQDCSQALKQSP                                                        1891 - 1907
//

Text Mined References (42)

PMID Year Title
27170179 2016 Dual function of cTAGE5 in collagen export from the endoplasmic reticulum.
27138255 2016 TANGO1 and Mia2/cTAGE5 (TALI) cooperate to export bulky pre-chylomicrons/VLDLs from the endoplasmic reticulum.
26568311 2015 TANGO1 recruits ERGIC membranes to the endoplasmic reticulum for procollagen export.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25416956 2014 A proteome-scale map of the human interactome network.
25202031 2014 Concentration of Sec12 at ER exit sites via interaction with cTAGE5 is required for collagen export.
24889917 2014 Transport and Golgi organisation protein 1 is a novel tumour progressive factor in oral squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24125424 2013 Meta-analysis identifies robust association between SNP rs17465637 in MIA3 on chromosome 1q41 and coronary artery disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...