Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.58
PubTator Score 4.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

Gene RIF (1)

PMID Text
24606217 40 novel TCTEX1D4 interactors in human spermatozoa have been identified.

AA Sequence

MASRPLPPGRQEEENAKDSGRKPSPVRPRGCLPSIDEARPAGPGPAPASRRGSMLGLAASFSRRNSLVGP      1 - 70
GAGPGGQRPSLGPVPPLGSRVSFSGLPLAPARWVAPSYRTEPVPGERWEAARAQRALEAALAAGLHDACY     71 - 140
SSDEAARLVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLF    141 - 210
AVATVHGLYCE                                                               211 - 221
//

Text Mined References (7)

PMID Year Title
24606217 2014 TCTEX1D4 interactome in human testis: unraveling the function of dynein light chain in spermatozoa.
23789093 2013 TCTEX1D4, a novel protein phosphatase 1 interactor: connecting the phosphatase to the microtubule network.
21382349 2011 Identification of the human testis protein phosphatase 1 interactome.
16982625 2006 Identification of Tctex2beta, a novel dynein light chain family member that interacts with different transforming growth factor-beta receptors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.