Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.89
PubTator Score 3.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
pancreatic cancer -2.000 6.5e-05
adult high grade glioma -1.100 1.0e-03
astrocytic glioma -1.700 1.2e-02
Astrocytoma, Pilocytic -1.400 1.0e-07
atypical teratoid / rhabdoid tumor -2.800 7.1e-04
cystic fibrosis -1.800 2.8e-03
ependymoma -2.100 8.0e-03
glioblastoma -1.300 8.8e-10
group 3 medulloblastoma -1.300 1.5e-03
interstitial cystitis -1.900 2.9e-04
intraductal papillary-mucinous adenoma (... -2.300 6.4e-05
intraductal papillary-mucinous carcinoma... -2.700 5.1e-05
intraductal papillary-mucinous neoplasm ... -2.800 4.8e-04
lung cancer 2.000 2.1e-03
lung carcinoma 2.200 1.4e-15
medulloblastoma, large-cell -3.400 8.2e-05
oligodendroglioma -1.600 1.9e-02
ovarian cancer -1.800 7.1e-20
pituitary cancer -1.100 2.1e-02
progressive supranuclear palsy 1.200 1.6e-02

Gene RIF (6)

AA Sequence

MSVPVAPKKSCYTQLRDNRNAARNNNESILSLGDTNANQIMLEVSSSHDESKTCDLGDEIGNTNSSEPEN      1 - 70
RTHFHKEFHQLQGFGKGSQAGSASLKDFRLSSTIQRELNEEHTVERGTDSLQTTRSIQGPSLSSWRNVMS     71 - 140
EASLDVLAKRDAEIPRHVPKDKLAKTLDNEELRRHSLERASSSVAAVGSLTPQHPQPLSLDSREARGQIP    141 - 210
GGGEGPQKTLPDHAVPAAFPATDSTSEGKSVRHPKPSTSESKQSTPSETQTVGAHVLQVCSEHTSHSAHP    211 - 280
EPALNLTLASKEIPSKLEAQLGQGKGEAKLDLKYVPPRRVEQEGKAAQEGYLGCHKEENLSALEGRDPCG    281 - 350
EAHPEATDALGHLLNSDLHHLGVGRGNCEEKRGVNPGEQDSLHTTPKQGSASLGGADNQPTGKISPCAGE    351 - 420
KLGERTSSSFSPGDSHVAFIPNNLTDSKPLDVIEEERRLGSGNKDSVMVLVFNPSVGENKTEVPEPLDPQ    421 - 490
SGRSEARESKEVTTSVAENRNLLENADKIESTSARADSVLNIPAPLHPETTVNMTYQPTTPSSSFQDVSV    491 - 560
FGMDAGSPLVVPPPTDSARLLNTSPKVPDKNTCPSGIPKPVFTHSKDTPSSQEGMENYQVEKTEERTETK    561 - 630
PIIMPKPKHVRPKIITYIRRNPQALGQVDASLVPVGLPYAPPTCTMPLPHEEKAAGGDLKPSANLYEKFK    631 - 700
PDLQKPRVFSSGLMVSGIKPPGHPFSQMSEKFLQEVTDHPGKEEFCSPPYAHYEVPPTFYRSAMLLKPQL    701 - 770
GLGAMSRLPSAKSRILIASQRSSASAIHPPGPITTATSLYSSDPSADLKKASSSNAAKSNLPKSGLRPPG    771 - 840
YSRLPAAKLAAFGFVRSSSVSSVSSTQSGDSAQPEQGRPATRSTFGNEEQPVLKASLPSKDTPKGAGRVA    841 - 910
PPASSSVTAPRRSLLPAPKSTSTPAGTKKDAQKDQDTNKPAVSSPKRVAASTTKLHSPGYPKQRTAAARN    911 - 980
GFPPKPDPQAREAERQLVLRLKERCEQQTRQLGVAQGELKRAICGFDALAVATQHFFRKNESALVKEKEL    981 - 1050
SIELANIRDEVAFHTAKCEKLQKEKEELERRFEDEVKRLGWQQQAELQELEERLQLQFEAEMARLQEEHG   1051 - 1120
DQLLSIRCQHQEQVEDLTASHDAALLEMENNHTVAITILQDDHDHKVQELMSTHELEKKELEENFEKLRL   1121 - 1190
SLQDQVDTLTFQSQSLRDRARRFEEALRKNTEEQLEIALAPYQHLEEDMKSLKQVLEMKNQQIHEQEKKI   1191 - 1260
LELEKLAEKNIILEEKIQVLQQQNEDLKARIDQNTVVTRQLSEENANLQEYVEKETQEKKRLSRTNEELL   1261 - 1330
WKLQTGDPTSPIKLSPTSPVYRGSSSGPSSPARVSTTPR                                  1331 - 1369
//

Text Mined References (20)

PMID Year Title