Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 5.3291383654813E-19
adult high grade glioma 2148 8.56041067393708E-7
atypical teratoid / rhabdoid tumor 4369 4.25858493648269E-6
glioblastoma 5572 6.43430949571126E-6
group 3 medulloblastoma 2254 4.20480899078411E-5
oligodendroglioma 2849 0.0014778074000187
primitive neuroectodermal tumor 3031 0.00174487140164255
astrocytic glioma 2241 0.00204531934271855
psoriasis 6685 0.00796531601992237
subependymal giant cell astrocytoma 2287 0.0347179093190177

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.400 0.002
ependymoma -1.700 0.000
oligodendroglioma -1.400 0.001
glioblastoma -1.400 0.000
group 3 medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
primitive neuroectodermal tumor -1.300 0.002
adult high grade glioma -1.700 0.000
subependymal giant cell astrocytoma -1.508 0.035
psoriasis -1.400 0.008

AA Sequence

MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKG      1 - 70
RPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQE     71 - 140
SAERAIDVMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR              141 - 200
//

Text Mined References (4)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.