Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.400 0.002
ependymoma -1.700 0.000
oligodendroglioma -1.400 0.001
glioblastoma -1.400 0.000
group 3 medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
primitive neuroectodermal tumor -1.300 0.002
adult high grade glioma -1.700 0.000
subependymal giant cell astrocytoma -1.508 0.035
psoriasis -1.400 0.008

AA Sequence

MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKG      1 - 70
RPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQE     71 - 140
SAERAIDVMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR              141 - 200
//

Text Mined References (4)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.