Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.700 8.6e-07
astrocytic glioma -1.400 2.0e-03
atypical teratoid / rhabdoid tumor -1.300 4.3e-06
ependymoma -1.400 3.5e-03
glioblastoma -1.400 6.4e-06
group 3 medulloblastoma -1.800 4.2e-05
oligodendroglioma -1.400 1.5e-03
primitive neuroectodermal tumor -1.300 1.7e-03
psoriasis -1.400 8.0e-03
subependymal giant cell astrocytoma -1.508 3.5e-02

AA Sequence

MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKG      1 - 70
RPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQE     71 - 140
SAERAIDVMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR              141 - 200
//

Text Mined References (4)

PMID Year Title