Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5JQF7 B0S7Y3 B0V298 Q5SNN6 Q96KW1
Symbols C6orf100
dJ25J6.5

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLQVVQEGNPAPFIINTVKRGRRDRERQRTPWAPHPLGFQGRRYIYESPNHRGKDSSFLAQK              1 - 62
//

Text Mined References (2)

PMID Year Title
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
14574404 2003 The DNA sequence and analysis of human chromosome 6.