Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5JQF7 B0S7Y3 B0V298 Q5SNN6 Q96KW1
Symbols C6orf100
dJ25J6.5

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MLQVVQEGNPAPFIINTVKRGRRDRERQRTPWAPHPLGFQGRRYIYESPNHRGKDSSFLAQK              1 - 62
//

Text Mined References (2)

PMID Year Title