Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.27
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis and treatment for 6 months 1.100 0.000
sarcoidosis 1.200 0.022
primary Sjogren syndrome 1.200 0.002
ovarian cancer 1.500 0.002

AA Sequence

MEMSGLSFSEMEGCRNLLGLLDNDEIMALCDTVTNRLVQPQDRQDAVHAILAYSQSAEELLRRRKVHREV      1 - 70
IFKYLATQGIVIPPATEKHNLIQHAKDYWQKQPQLKLKETPEPVTKTEDIHLFQQQVKEDKKAEKVDFRR     71 - 140
LGEEFCHWFFGLLNSQNPFLGPPQDEWGPQHFWHDVKLRFYYNTSEQNVMDYHGAEIVSLRLLSLVKEEF    141 - 210
LFLSPNLDSHGLKCASSPHGLVMVGVAGTVHRGNTCLGIFEQIFGLIRCPFVENTWKIKFINLKIMGESS    211 - 280
LAPGTLPKPSVKFEQSDLEAFYNVITVCGTNEVRHNVKQASDSGTGDQV                         281 - 329
//

Text Mined References (8)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21177773 2011 Acetaminophen-NAPQI hepatotoxicity: a cell line model system genome-wide association study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17464193 2007 Identification of novel regulators of apoptosis using a high-throughput cell-based screen.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.