Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.27
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis and treatment for 6 months 686 1.56258588884023E-5
ovarian cancer 8492 0.00205243778935401
primary Sjogren syndrome 789 0.00235211025718958
sarcoidosis 368 0.0217923798014625

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis and treatment for 6 months 1.100 0.000
sarcoidosis 1.200 0.022
primary Sjogren syndrome 1.200 0.002
ovarian cancer 1.500 0.002

Synonym

Accession Q5JPI3 B2R8X6 Q8TC85
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 GO Process (1)

AA Sequence

MEMSGLSFSEMEGCRNLLGLLDNDEIMALCDTVTNRLVQPQDRQDAVHAILAYSQSAEELLRRRKVHREV      1 - 70
IFKYLATQGIVIPPATEKHNLIQHAKDYWQKQPQLKLKETPEPVTKTEDIHLFQQQVKEDKKAEKVDFRR     71 - 140
LGEEFCHWFFGLLNSQNPFLGPPQDEWGPQHFWHDVKLRFYYNTSEQNVMDYHGAEIVSLRLLSLVKEEF    141 - 210
LFLSPNLDSHGLKCASSPHGLVMVGVAGTVHRGNTCLGIFEQIFGLIRCPFVENTWKIKFINLKIMGESS    211 - 280
LAPGTLPKPSVKFEQSDLEAFYNVITVCGTNEVRHNVKQASDSGTGDQV                         281 - 329
//

Text Mined References (8)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21177773 2011 Acetaminophen-NAPQI hepatotoxicity: a cell line model system genome-wide association study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17464193 2007 Identification of novel regulators of apoptosis using a high-throughput cell-based screen.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.