Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5JNZ5
Symbols RPS26L1
bA366E13.1
RPS26_22_1784

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MTKKRRNNSHAKKGRGHVQPIRCTNCVRCVPTDKAIKKFVIRNIVEAAAVRDISEVSVFDAYVLPKLYVK      1 - 70
LHYCVSCAIHSKVVRNRSREACKDRTPPPRFRPAGAAPRPPPKPM                              71 - 115
//

Text Mined References (2)

PMID Year Title
19123937 2009 Comparative analysis of processed ribosomal protein pseudogenes in four mammalian genomes.
15772651 2005 The DNA sequence of the human X chromosome.