Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.28
PubTator Score 0.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (2)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)
18309376 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MQEVVLLDESSGPPSQLLWTRQDTQLPQESALLPAPYPAFTKDGSQGNLPQADITLMSQAQESVTFEDVA      1 - 70
VNFTNREWQCLTYAQRHLYKDVMLENYGNMVSLGFPFPKPPLISHLEREVDPCVQDPQDRESLSCSYPVS     71 - 140
ADKMWPENEKASSQQEIFENGEAYWMKFNSLLKVDSRDPKVREVCVQDVKLENQWETSIREKLREEKEGS    141 - 210
EEVTCKKGKNQKVLSKNLNPNSKHSQCNKVLIAQKLHECARCGKNFSWHSDLILHEQIHSGEKPHVCNEC    211 - 280
GKAFKTRNQLSMHRIIHTGEKPFNCTQCGKAFNSRSALCRHKKTHSGEKPHECRDCGKAFKTRNRLCMHQ    281 - 350
LIHTGEKPYKCNCCGKAFQFKHSLTIHGRIHTGEKPYECEECGKAFSGSSDLTKHIRIHTGERPYECSKC    351 - 420
GRAFSRSSDLSKHKRIHTREKHYGCPQCGKDFSIKAELTKHRRIHTEEKRYRCEECGKAFRHNCKRRAHE    421 - 490
REHTGEKPYQCRDCGKTFQDKHCLTIHQRIHTGEKPYKCLECGKAFSGKSNLTNHRRIHTGEKPHKCEVC    491 - 560
GMAFHHSSVLRQHKRIHTGEKPYTCSECGTSFRQGSALIGHKRVHTGEKPYECEECGKAFRVSSNLTGHK    561 - 630
KRKHQVWSTHELDGSRKSLSPVTVSQTSVVSILTSA                                      631 - 666
//

Text Mined References (8)

PMID Year Title
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18309376 Several regions in the major histocompatibility complex confer risk for anti-CCP-antibody positive rheumatoid arthritis, independent of the DRB1 locus.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10520746 1998 Computer sequence analysis of human highly conserved zinc finger modules.