Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.38
PubTator Score 0.47

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.200 4.6e-04
ependymoma 1.200 1.3e-08
glioblastoma 1.200 6.9e-06
group 3 medulloblastoma 1.600 3.5e-04
intraductal papillary-mucinous adenoma (... 1.200 7.7e-03
osteosarcoma -1.757 1.2e-04
primitive neuroectodermal tumor 1.200 8.4e-03

Gene RIF (2)

AA Sequence

MQEVVLLDESSGPPSQLLWTRQDTQLPQESALLPAPYPAFTKDGSQGNLPQADITLMSQAQESVTFEDVA      1 - 70
VNFTNREWQCLTYAQRHLYKDVMLENYGNMVSLGFPFPKPPLISHLEREVDPCVQDPQDRESLSCSYPVS     71 - 140
ADKMWPENEKASSQQEIFENGEAYWMKFNSLLKVDSRDPKVREVCVQDVKLENQWETSIREKLREEKEGS    141 - 210
EEVTCKKGKNQKVLSKNLNPNSKHSQCNKVLIAQKLHECARCGKNFSWHSDLILHEQIHSGEKPHVCNEC    211 - 280
GKAFKTRNQLSMHRIIHTGEKPFNCTQCGKAFNSRSALCRHKKTHSGEKPHECRDCGKAFKTRNRLCMHQ    281 - 350
LIHTGEKPYKCNCCGKAFQFKHSLTIHGRIHTGEKPYECEECGKAFSGSSDLTKHIRIHTGERPYECSKC    351 - 420
GRAFSRSSDLSKHKRIHTREKHYGCPQCGKDFSIKAELTKHRRIHTEEKRYRCEECGKAFRHNCKRRAHE    421 - 490
REHTGEKPYQCRDCGKTFQDKHCLTIHQRIHTGEKPYKCLECGKAFSGKSNLTNHRRIHTGEKPHKCEVC    491 - 560
GMAFHHSSVLRQHKRIHTGEKPYTCSECGTSFRQGSALIGHKRVHTGEKPYECEECGKAFRVSSNLTGHK    561 - 630
KRKHQVWSTHELDGSRKSLSPVTVSQTSVVSILTSA                                      631 - 666
//

Text Mined References (8)

PMID Year Title